DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and Zdhhc23

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001007461.1 Gene:Zdhhc23 / 332175 MGIID:2685625 Length:425 Species:Mus musculus


Alignment Length:277 Identity:78/277 - (28%)
Similarity:116/277 - (41%) Gaps:58/277 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 YADYVVIRWIILTTMPGSLWMSFHVVLFNTVVFLLAMSHSKAVFSDPGTV---PLPAN-RLDFSD 82
            |..||.:|.::.....|...::  ::....::.|||:..:|   .:||.:   ..|:| :::...
Mouse   145 YMYYVFLREVVPQGRVGPTQLA--LLTCGLLLILLALYRAK---KNPGYLSNDKSPSNSQIECPV 204

  Fly    83 LHTTNKNNPPPGNGHS---------------------------SEWTVCTRCETYRPPRAHHCRI 120
            .....|....||...|                           .:|  |.:|:..||.||.||||
Mouse   205 KKGQEKTKGFPGTDASGSLNNRTLKDDVRGSSRVGLDSPAKVKEDW--CAKCQLVRPARAWHCRI 267

  Fly   121 CKRCIRRMDHHCPWINNCVGERNQKYFLQFLIYVALLSLYSIALIVGSWVWPCEECSQNVIETQL 185
            |..|:|||||||.|||:||||.|.:.|:..|....|.|:|.|:|.:.:      .|....:.|.|
Mouse   268 CGICVRRMDHHCVWINSCVGESNHQAFILALSIFLLTSVYGISLTLNT------ICRDRSLFTAL 326

  Fly   186 RMIHSVILMLVSAL------FGLFVTA----IMVDQLHAILYDETAVEAIQQKGTYRPNRRKY-Q 239
            .....|.....|||      :.:.:||    |.:.||..|.|:.|..| :||....:..||.. .
Mouse   327 FYCPGVYANYSSALSFTCVWYSVIITAGMAYIFLIQLINISYNVTERE-VQQALRQKTGRRLLCG 390

  Fly   240 LLADV--FGRGHPALWL 254
            |:.|.  :.||....||
Mouse   391 LIVDTGQYNRGFLRNWL 407

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 53/167 (32%)
Zdhhc23NP_001007461.1 DHHC 248..374 CDD:396215 50/133 (38%)
Interaction with NOS1. /evidence=ECO:0000250 422..425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.