DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and Zdhhc8

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:XP_006248672.1 Gene:Zdhhc8 / 303796 RGDID:1308875 Length:775 Species:Rattus norvegicus


Alignment Length:210 Identity:62/210 - (29%)
Similarity:91/210 - (43%) Gaps:28/210 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 WIILTTMPGSLWMSFHVVLFNTVVFLLAMSH-SKAVFSDPGTVPLPANRLDFSD-----LHTTNK 88
            |:.....|.       :.::|.::||..::: |.|.|.|||..|......|..|     |:   |
  Rat    38 WLTRAVSPA-------IPVYNGILFLFVLANFSMATFMDPGVFPRADEDEDKEDDFRAPLY---K 92

  Fly    89 NNPPPGNGHSSEWTVCTRCETYRPPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFLQFLIY 153
            |....|.....:|  |..|..|||||..||.:|..|:...||||||:|||:|.||.:||..||: 
  Rat    93 NVDVRGIQVRMKW--CATCHFYRPPRCSHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLL- 154

  Fly   154 VALLSLYSIALIVGSWVWPCEECSQNVIETQLRMIHSVILMLVSALFGL-FVTAIMVDQLHAILY 217
              .||.:.:.::....::....      ...|...|:.|.|.|..:.|| |:..|.:...|.:|.
  Rat   155 --SLSAHMVGVVAFGLLYVLNH------SEGLGAAHTTITMAVMCVAGLFFIPVIGLTGFHVVLV 211

  Fly   218 DETAVEAIQQKGTYR 232
            ........|..|.:|
  Rat   212 TRGRTTNEQVTGKFR 226

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 42/131 (32%)
Zdhhc8XP_006248672.1 zf-DHHC 99..224 CDD:279823 42/135 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.