DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and Zdhhc22

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001034414.1 Gene:Zdhhc22 / 299211 RGDID:1308446 Length:263 Species:Rattus norvegicus


Alignment Length:263 Identity:70/263 - (26%)
Similarity:104/263 - (39%) Gaps:63/263 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 ILTTMPGSLWMSFHVVLFNTVVFLLAMSHSKAVFSDPGTVP--------------LPANRLDFSD 82
            :|..:..:.::...:|.|...:||...|    :..||...|              |.||.|  .:
  Rat     6 LLNVVAPAYFLCISLVTFVLQLFLFLPS----MREDPTATPLFSPAVLHGALFLFLSANAL--GN 64

  Fly    83 LHTTNKNNPPPGNGHSSEWTVCTRCETYR----PPRAHHCRICKRCIRRMDHHCPWINNCVGERN 143
            .....:|:|       .:...|....:.|    ||..|.||:|.|...|.||||.:..||:|.||
  Rat    65 YILVVQNSP-------DDLGACQGTSSQRPQRPPPSTHFCRVCARVTLRHDHHCFFTGNCIGSRN 122

  Fly   144 QKYFLQFLIYVALLSLYSI--------ALIVGSWVWPCEECSQNVIETQLRMIHS---------V 191
            .:.|:.|.:|.:|..|||:        |::..|:..|.  ....::.|.:....|         |
  Rat   123 MRNFILFCLYTSLACLYSMVAGVAYISAVLSISFAHPL--AFLTLLPTSISQFFSGAVLGSDMFV 185

  Fly   192 ILML-VSALFGLFVTAIMVDQLHAILYDETAVEAIQQKGT---YRPNRRKYQLLADVFGRGHPAL 252
            |||| :....||........||..||..:|..:.  :||.   .||.|:..|   :|||:    .
  Rat   186 ILMLYLWFAVGLACAGFCCHQLLLILRGQTRYQV--RKGVAVRARPWRKNLQ---EVFGK----R 241

  Fly   253 WLL 255
            |||
  Rat   242 WLL 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 43/152 (28%)
Zdhhc22NP_001034414.1 DHHC 91..218 CDD:396215 41/128 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.