DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and ZDHHC8

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001171953.1 Gene:ZDHHC8 / 29801 HGNCID:18474 Length:778 Species:Homo sapiens


Alignment Length:250 Identity:72/250 - (28%)
Similarity:102/250 - (40%) Gaps:48/250 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 WIILTTMPGSLWMSFHVVLFNTVVFLLAMSH-SKAVFSDPGTVPLPANRLDFSD-----LHTTNK 88
            |:.....|.       |.::|.::||..::: |.|.|.|||..|......|..|     |:   |
Human    38 WLTRAVSPA-------VPVYNGIIFLFVLANFSMATFMDPGVFPRADEDEDKEDDFRAPLY---K 92

  Fly    89 NNPPPGNGHSSEWTVCTRCETYRPPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFLQFLIY 153
            |....|.....:|  |..|..|||||..||.:|..|:...||||||:|||:|.||.:||..||: 
Human    93 NVDVRGIQVRMKW--CATCHFYRPPRCSHCSVCDNCVEDFDHHCPWVNNCIGRRNYRYFFLFLL- 154

  Fly   154 VALLSLYSIALIVGSWVWPCEECSQNVIETQLRMIHSVILMLVSALFGL-FVTAIMVDQLHAILY 217
              .||.:.:.::....|:......      .|...|:.|.|.|..:.|| |:..|.:...|.:|.
Human   155 --SLSAHMVGVVAFGLVYVLNHAE------GLGAAHTTITMAVMCVAGLFFIPVIGLTGFHVVLV 211

  Fly   218 DETAVEAIQQKGTYRPNRRKYQLLADVFGRGHPALWLLPCTSLNH------ASRY 266
            ........|..|.:|..       .:.|.||       .|.::.|      |.||
Human   212 TRGRTTNEQVTGKFRGG-------VNPFTRG-------CCGNVEHVLCSPLAPRY 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 43/131 (33%)
ZDHHC8NP_001171953.1 DHHC 99..224 CDD:366691 43/135 (32%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..352
PHA03247 <333..771 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 509..540
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.