DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and Zdhhc24

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001034189.1 Gene:Zdhhc24 / 293665 RGDID:1565630 Length:284 Species:Rattus norvegicus


Alignment Length:213 Identity:58/213 - (27%)
Similarity:82/213 - (38%) Gaps:75/213 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 SLWMSFHVVLFNTVVFLLAMSHSKAVFSDPGTVPLP----ANRLDFSDLHTTN---------KNN 90
            :||.:. |||..|.|.:|.          ||..||.    |.:|..:.....|         :::
  Rat    23 ALWAAV-VVLELTYVMVLG----------PGPPPLEPLARALQLALAAYQLLNLLGNMGLFLRSD 76

  Fly    91 PP------PGNGHSSEWTVCTRCETYRPPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFLQ 149
            |.      .|.|....|..|.:|::..|||:.||..|:.||.|.||||..:..|||..|.:.||.
  Rat    77 PSIRGVMLAGRGLGQGWAYCYQCQSQVPPRSGHCSACRVCILRRDHHCRLLGRCVGFHNYRPFLC 141

  Fly   150 FLIYVA--------LLS------------LYSIALIVGSWVWPCEECSQNVIETQLRMIHSVILM 194
            .|::.|        |||            ||::||::..|                       ||
  Rat   142 LLLHAAGVLLHISVLLSPALSALLQAHSALYTVALLLLPW-----------------------LM 183

  Fly   195 LVSALFGL--FVTAIMVD 210
            |::....|  |..|.:||
  Rat   184 LLTGKVSLAQFALAFVVD 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 40/136 (29%)
Zdhhc24NP_001034189.1 zf-DHHC 95..234 CDD:279823 39/130 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.