Sequence 1: | NP_477449.1 | Gene: | Dnz1 / 34503 | FlyBaseID: | FBgn0027453 | Length: | 276 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_056272.2 | Gene: | ZDHHC5 / 25921 | HGNCID: | 18472 | Length: | 715 | Species: | Homo sapiens |
Alignment Length: | 207 | Identity: | 65/207 - (31%) |
---|---|---|---|
Similarity: | 100/207 - (48%) | Gaps: | 24/207 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 35 TMPG-SLWMSFHVVLFNTVVFLLAMSH-SKAVFSDPGTVPLPANRLDFSD-----LHTTNKNNPP 92
Fly 93 PGNGHSSEWTVCTRCETYRPPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFLQFLIYVA-- 155
Fly 156 LLSLYSIALIVGSWVWPCEECSQNVIETQLRMIHSVILMLVSALFGLFVTAIMVDQLHAILYDET 220
Fly 221 AVEAIQQKGTYR 232 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Dnz1 | NP_477449.1 | DHHC | 97..228 | CDD:396215 | 41/132 (31%) |
ZDHHC5 | NP_056272.2 | DHHC | 99..224 | CDD:366691 | 41/136 (30%) |
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 289..715 | ||||
DUF4671 | 594..>704 | CDD:374041 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_COG5273 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.810 |