DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and swf1

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_596556.1 Gene:swf1 / 2539719 PomBaseID:SPBC13G1.07 Length:356 Species:Schizosaccharomyces pombe


Alignment Length:159 Identity:45/159 - (28%)
Similarity:74/159 - (46%) Gaps:36/159 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 GIACLVVTYGAVLYADYVVIRWIILTTMPGSLWMSFHVVLFNTVVFLLAMSHSKAVFSDPGTVPL 73
            |||...: ||:.|...:.:|.||.:.|.....::|.::                |..|:||    
pombe    91 GIASFFI-YGSSLTQKFSIIDWISVLTSVLLPYISLYI----------------AAKSNPG---- 134

  Fly    74 PANRLDFSDLHTTNKNNPPPGNGHSSEWTV-----CTRCETYRPPRAHHCRICKRCIRRMDHHCP 133
               ::|..:.:..::..|       .::.:     |:.|:..:|.|:.|||:|..|:.:.||||.
pombe   135 ---KIDLKNWNEASRRFP-------YDYKIFFPNKCSTCKFEKPARSKHCRLCNICVEKFDHHCI 189

  Fly   134 WINNCVGERNQKYFLQFLIYVALLSLYSI 162
            |||||||..|.:||..||:....|..:||
pombe   190 WINNCVGLNNARYFFLFLLCTIQLLFHSI 218

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 28/71 (39%)
swf1NP_596556.1 COG5273 47..356 CDD:227598 45/159 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.