DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and ZDHHC20

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001316988.1 Gene:ZDHHC20 / 253832 HGNCID:20749 Length:365 Species:Homo sapiens


Alignment Length:307 Identity:81/307 - (26%)
Similarity:129/307 - (42%) Gaps:96/307 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 VVTYGAVLYADYVVIRWIILTTMPGSLWMSFHVV-------LF------NTVVFLLAM------- 58
            ||.:..||:..:||:            |..:..|       :|      .|||:|:|.       
Human    13 VVGWVPVLFITFVVV------------WSYYAYVVELCVFTIFGNEENGKTVVYLVAFHLFFVMF 65

  Fly    59 --SHSKAVFSDPGTVPLPANRL------------DFSD---------------LHTTNKNNPPPG 94
              |:...:|:.|.:   |:...            :||.               ::||        
Human    66 VWSYWMTIFTSPAS---PSKEFYLSNSEKERYEKEFSQERQQEILRRAARALPIYTT-------- 119

  Fly    95 NGHSSEWTV--CTRCETYRPPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFLQFLIYVALL 157
               |:..|:  |.:|:..:|.|||||..|..||.:|||||||:|||||..|.|:||.||:|..|.
Human   120 ---SASKTIRYCEKCQLIKPDRAHHCSACDSCILKMDHHCPWVNNCVGFSNYKFFLLFLLYSLLY 181

  Fly   158 SLYSIALIVGSWV--WPCEECSQNVIETQLRMIHSVILMLVSALFGLFVTAIMVDQLHAILY--D 218
            .|:..|.::..::  |     :..:.:|:.: .|.:.|..|||:|  |::.:.:...|..|.  :
Human   182 CLFVAATVLEYFIKFW-----TNELTDTRAK-FHVLFLFFVSAMF--FISVLSLFSYHCWLVGKN 238

  Fly   219 ETAVEAIQQKG-TYRPNRRKYQL-----LADVFGRGHPALWLLPCTS 259
            .|.:|:.:... :|.|:...:.|     ...||| .....||||..|
Human   239 RTTIESFRAPTFSYGPDGNGFSLGCSKNWRQVFG-DEKKYWLLPIFS 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 48/136 (35%)
ZDHHC20NP_001316988.1 zf-DHHC 16..301 CDD:327686 79/304 (26%)
Substrate binding. /evidence=ECO:0000305|PubMed:29326245 140..143 2/2 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165157938
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.750

Return to query results.
Submit another query.