DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and Zdhhc2

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_659564.3 Gene:Zdhhc2 / 246326 RGDID:628681 Length:366 Species:Rattus norvegicus


Alignment Length:248 Identity:69/248 - (27%)
Similarity:111/248 - (44%) Gaps:49/248 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    42 MSFHVVLFNTVVFLLAMSHSKAVFSDPGTVPL-PANRLDFSDLHTTNKNNPPPGNGH-------- 97
            |::| :||...|:    |:.|.:|    |:|: |:.....|..........|.|..|        
  Rat    56 MAYH-LLFAMFVW----SYWKTIF----TLPMNPSKEFHLSYAEKELLEREPRGEAHQEVLRRAA 111

  Fly    98 ----------SSEWTVCTRCETYRPPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFLQFLI 152
                      |.....|.||...:|.|.|||.:|.:||.:|||||||:|||||..|.|:||.||.
  Rat   112 KDLPIYTRTMSGAIRYCDRCRLIKPDRCHHCSVCDKCILKMDHHCPWVNNCVGFSNYKFFLLFLA 176

  Fly   153 YVALLSLYSIALIVGSWV--WPCEECSQNVIETQLRMIHSVILMLVSALFGLFVTAIMVDQLHAI 215
            |..|..|:..|..:..::  |     :..:.:||.: .|.:.|...:|:|.:.::::.......:
  Rat   177 YSLLYCLFIAATDLQYFIRFW-----TNGLPDTQAK-FHIMFLFFAAAMFSVSLSSLFGYHCWLV 235

  Fly   216 LYDETAVEAIQ----QKGTYRPNRRKYQL-----LADVFGRGHPALWLLPCTS 259
            ..:::.:||.:    :.||   ::..:.|     :..||| .....||||..|
  Rat   236 SKNKSTLEAFRNPVFRHGT---DKNGFSLGFSKNMRQVFG-DEKKYWLLPIFS 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 44/154 (29%)
Zdhhc2NP_659564.3 DHHC 19..301 CDD:418707 69/248 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 297..366
Mediates localization to plasma membrane and recycling endosomes. /evidence=ECO:0000250|UniProtKB:P59267 298..366
Non-canonical dileucine endocytic signal. /evidence=ECO:0000250|UniProtKB:P59267 334..335
NPxY-like endocytic signal. /evidence=ECO:0000250|UniProtKB:P59267 357..360
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166351937
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1491968at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
54.750

Return to query results.
Submit another query.