DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and Zdhhc14

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_666185.3 Gene:Zdhhc14 / 224454 MGIID:2653229 Length:489 Species:Mus musculus


Alignment Length:235 Identity:60/235 - (25%)
Similarity:109/235 - (46%) Gaps:34/235 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 IILTTMPGSLWMSFH-----------VVLFNTVVFLLAM-SHSKAVFSDPGTVPLPA-------- 75
            :||..:...|:.:|.           :.:...::|...| :..:..|||||.:|...        
Mouse    68 LILILVTSGLFFAFDCRYLAEKITPAIPVVGGILFFFVMGTLLRTSFSDPGVLPRATPDEAADLE 132

  Fly    76 NRLDFSDLHTTNKNNPPPG------NGHSSEWTVCTRCETYRPPRAHHCRICKRCIRRMDHHCPW 134
            .::|.::..::....|||.      ||.:.:...|..|:.:|||||.||.:|..|:.:.||||||
Mouse   133 RQIDIANGTSSGGYRPPPRTKEVVINGQTVKLKYCFTCKIFRPPRASHCSLCDNCVEQFDHHCPW 197

  Fly   135 INNCVGERNQKYFLQFLIYVALLSLYSIALIVGSWVWPCEECSQNVIETQLRMIHSVILMLVSAL 199
            :.||||:||.::|..|::.::.|:::..|.::...:   ....|......|:...:.:|..|...
Mouse   198 VGNCVGKRNYRFFYMFILSLSFLTVFIFAFVITHVI---HRSQQKGFLDALKDSPASVLEAVICF 259

  Fly   200 FGLFVTAIMVDQLHAILY--DETAVEAIQQKGTYRPNRRK 237
            |.:: :.|.:...|..|.  ::|..|.|  ||::...|.|
Mouse   260 FSVW-SIIGLSGFHTYLISSNQTTNEDI--KGSWSNKRGK 296

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 38/132 (29%)
Zdhhc14NP_666185.3 zf-DHHC 164..289 CDD:307600 39/130 (30%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 434..454
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.