DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and dhhc-10

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_508805.3 Gene:dhhc-10 / 180745 WormBaseID:WBGene00019344 Length:327 Species:Caenorhabditis elegans


Alignment Length:64 Identity:28/64 - (43%)
Similarity:37/64 - (57%) Gaps:2/64 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    93 PGNGHSSEWTVCTRCETYRPPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFLQFLIYVAL 156
            |.|...|::  |..|....|.|:|||.:||.|:.|.||||.....|||..||:||:.||.:.|:
 Worm   124 PANESGSKF--CFTCNKEAPQRSHHCPLCKMCVLRKDHHCFITGACVGLGNQRYFMVFLFWCAI 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 26/60 (43%)
dhhc-10NP_508805.3 zf-DHHC 129..270 CDD:279823 26/59 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.