powered by:
Protein Alignment Dnz1 and slc66a1l
DIOPT Version :9
Sequence 1: | NP_477449.1 |
Gene: | Dnz1 / 34503 |
FlyBaseID: | FBgn0027453 |
Length: | 276 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001123690.1 |
Gene: | slc66a1l / 100170445 |
XenbaseID: | XB-GENE-5794175 |
Length: | 303 |
Species: | Xenopus tropicalis |
Alignment Length: | 44 |
Identity: | 13/44 - (29%) |
Similarity: | 19/44 - (43%) |
Gaps: | 8/44 - (18%) |
- Green bases have known domain annotations that are detailed below.
Fly 112 PPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFL--QFLIY 153
|...||.. :.:.||.||:....|.....:|: ||:||
Frog 240 PAVGHHMS------QYIMHHLPWLIGSFGVLILDFFMTAQFIIY 277
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
Dnz1 | NP_477449.1 |
DHHC |
97..228 |
CDD:396215 |
13/44 (30%) |
slc66a1l | NP_001123690.1 |
PQ-loop |
44..103 |
CDD:282099 |
|
PQ-loop |
185..238 |
CDD:282099 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.