DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Dnz1 and slc66a1l

DIOPT Version :9

Sequence 1:NP_477449.1 Gene:Dnz1 / 34503 FlyBaseID:FBgn0027453 Length:276 Species:Drosophila melanogaster
Sequence 2:NP_001123690.1 Gene:slc66a1l / 100170445 XenbaseID:XB-GENE-5794175 Length:303 Species:Xenopus tropicalis


Alignment Length:44 Identity:13/44 - (29%)
Similarity:19/44 - (43%) Gaps:8/44 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 PPRAHHCRICKRCIRRMDHHCPWINNCVGERNQKYFL--QFLIY 153
            |...||..      :.:.||.||:....|.....:|:  ||:||
 Frog   240 PAVGHHMS------QYIMHHLPWLIGSFGVLILDFFMTAQFIIY 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Dnz1NP_477449.1 DHHC 97..228 CDD:396215 13/44 (30%)
slc66a1lNP_001123690.1 PQ-loop 44..103 CDD:282099
PQ-loop 185..238 CDD:282099
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.