DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-3 and SET6

DIOPT Version :9

Sequence 1:NP_001260366.1 Gene:SmydA-3 / 34502 FlyBaseID:FBgn0262599 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_015160.1 Gene:SET6 / 855938 SGDID:S000006086 Length:373 Species:Saccharomyces cerevisiae


Alignment Length:121 Identity:33/121 - (27%)
Similarity:52/121 - (42%) Gaps:10/121 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly   166 YLRGPCQLANRFSEELIMQVVGVLEVNAF------EARSPKGYPLRCLFPYTGILAHNCVPNTSR 224
            |:..|..|....|..|:..::|....|||      ||...:.|....:||......|:|.||.::
Yeast   248 YILLPSHLHRMLSIPLLRHILGTEYGNAFGLWQEGEASDSREYFGYWVFPEASYFNHSCNPNITK 312

  Fly   225 SIYPSEGYKIRLRAMVDLEEGQPLHHSYTYTLD-GTAQRQKHLKQGKFFTCQCERC 279
            .   .:|..:......|:::.:.:...|:..|| .|.:|:..|....||.|.||||
Yeast   313 Y---RKGNSMLFTMNRDIKKDEQICIDYSGVLDLPTVKRRAFLADSWFFDCACERC 365

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-3NP_001260366.1 SET <207..252 CDD:250181 8/44 (18%)
SET6NP_015160.1 SET <1..370 CDD:225491 33/121 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.