powered by:
Protein Alignment SmydA-3 and ZMYND15
DIOPT Version :9
Sequence 1: | NP_001260366.1 |
Gene: | SmydA-3 / 34502 |
FlyBaseID: | FBgn0262599 |
Length: | 507 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001254751.1 |
Gene: | ZMYND15 / 84225 |
HGNCID: | 20997 |
Length: | 750 |
Species: | Homo sapiens |
Alignment Length: | 102 |
Identity: | 21/102 - (20%) |
Similarity: | 29/102 - (28%) |
Gaps: | 39/102 - (38%) |
- Green bases have known domain annotations that are detailed below.
Fly 46 PKCNGPVVCLGCYEPNPDPEEELCSECGWPLCVECAQQADNAHFRLECSQLKDARARFFRLPSGS 110
|:|:..:.| .|.|....|..|.: |...||:
Human 329 PQCSAVLYC-----------GEACLRADWQRCPD------------------DVSHRFW------ 358
Fly 111 RHCPQLDCIMPLRVLLAKEANPERWDNEVAPMEHHKE 147
||:|...|.....|| ..|..:..||.....:||
Human 359 --CPRLAAFMERAGELA--TLPFTYTAEVTSETFNKE 391
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E2759_KOG2084 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.