DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-3 and SmydA-2

DIOPT Version :9

Sequence 1:NP_001260366.1 Gene:SmydA-3 / 34502 FlyBaseID:FBgn0262599 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_649084.1 Gene:SmydA-2 / 40075 FlyBaseID:FBgn0036839 Length:530 Species:Drosophila melanogaster


Alignment Length:476 Identity:129/476 - (27%)
Similarity:223/476 - (46%) Gaps:36/476 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 VCGRYLVAKGAIRGHGLLIEELPFAVGPKCNGPVVCLGCYE-----PNPDPEEELCSECGWPLC- 77
            |.||:|.|...|:....:::|.|..:|||.....:||||:.     ..|......||.|.|||| 
  Fly    56 VLGRHLRATRDIKIGEQILKEAPLVLGPKVASAPLCLGCHRNLLAPGKPRGNYHKCSSCSWPLCG 120

  Fly    78 VECAQQADNAHFRLECSQLKDA--RARFFRLPSGSRHCPQLDC-IMPLRVLLAKEANPERWDNEV 139
            .||   .|:.|.:.||..:..:  :::...:|..........| ||.||.:..|:.:|:.: .::
  Fly   121 KEC---EDSVHHKAECQLMSGSNFQSKINYVPGEEERKESAYCVIMLLRCMHLKDKDPDAF-LKL 181

  Fly   140 APMEHHKEERQRDADVWHADRVNIAQYLRGPCQLANRFSEELIMQVVGVLEVNAFEARSPK-GYP 203
            ..:|.|.:|| .:..::...|.|:..:::....:.: :.|..|:::..:|:.|.||.|.|: ...
  Fly   182 YNLEDHLKER-LETPLYQVLRANLITFIKTVLGMKD-WPEMDILRIAAILDTNTFEVRQPRERRK 244

  Fly   204 LRCLFPYTGILAHNCVPNTSRSIYPSEGYKIRLRAMVDLEEGQPLHHSYTYTLDGTAQRQKHLKQ 268
            :|.|:|...:::|:||||.....  .:...|...|...:.:|:.|..|||..|..|.||:.||:|
  Fly   245 IRALYPGAAMISHDCVPNMRHRF--DDDMNIVFLAKRKIAKGEILSISYTQPLRSTIQRRVHLRQ 307

  Fly   269 GKFFTCQCERCLDPTELGTHFSSLKCGQCAEGFQVPRQPTEPDTSWNCANCGSDTSNADALAMLQ 333
            .|.|.|.|.||.||.|||:...:..|.:|..|..:...|......|.|..|....|..|.:....
  Fly   308 AKCFDCSCARCQDPEELGSFAGAQTCLKCKAGKIISLNPLLNSAPWKCQLCNFKRSAKDVVTSDA 372

  Fly   334 SLQSEVNAV-QALPMAAKRLEEIERLLRKYKSLLHPLHFIATGLRQLLIEMYGRVQGYEMVQLPD 397
            .||.|:.:: :..|:|      :|..:.::::.||..:......:..|.::||...|:.|.:|..
  Fly   373 ELQQELESLDKTTPVA------LEEFIYRHRADLHETNTHILQAKYALTQLYGSAPGFAMEELSG 431

  Fly   398 HQLERKAELCRQVLRVLNTFEPGLSRTRAMNLYELHVPLV---LLAKSGFIAGKLKGGELRARLV 459
            ..|.||.:||.::|::.:.|:.|.|..|...|.::...||   |.:|...        :...:|.
  Fly   432 ESLNRKLQLCEELLKLADIFDGGWSIFRGNLLIDMEEALVTQALRSKDPL--------DCEEKLR 488

  Fly   460 DAIDLLKECVEILEFEDKSSQ 480
            :|.::|:|...|::.|.:..|
  Fly   489 NAAEMLREIRNIMKHEPEMQQ 509

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-3NP_001260366.1 SET <207..252 CDD:250181 11/44 (25%)
SmydA-2NP_649084.1 zf-MYND 9..46 CDD:280009
SET <246..291 CDD:214614 12/46 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 77 1.000 Inparanoid score I1875
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR46455
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X2203
65.970

Return to query results.
Submit another query.