DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-3 and Smyd4-2

DIOPT Version :9

Sequence 1:NP_001260366.1 Gene:SmydA-3 / 34502 FlyBaseID:FBgn0262599 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_648574.1 Gene:Smyd4-2 / 39414 FlyBaseID:FBgn0036282 Length:663 Species:Drosophila melanogaster


Alignment Length:392 Identity:76/392 - (19%)
Similarity:134/392 - (34%) Gaps:92/392 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 GRYLVAKGAIRGHGLLIEELPFAV-------GPKC-------NGPVVCLGCYEPNPDPEEELCSE 71
            ||::||...:|...:|:.|.|.|.       |..|       :.||.||.|              
  Fly   265 GRFVVANEGLRTGDVLLFEEPVAACLEPSYFGTHCHHCFKRLHTPVSCLHC-------------- 315

  Fly    72 CGWPLC-VECAQQADNAHFRLECSQLKDARARFFRLPSGSRHCPQLDCIMPLRVLLAKEANPERW 135
            .|...| .:|..:|.:::.|.||..:.      ..:.||.    .:.|.:.||:.....:..:..
  Fly   316 SGIAFCSAQCMGEACSSYHRFECEYMD------LMIGSGM----SILCFIALRIFTQAPSLEQGL 370

  Fly   136 DNEVAPMEH---HKEERQRDADVWHADRVNIAQYLRGPCQLANRFSE-------------ELIMQ 184
            .......||   |:|:||.|.   :..|..::.:|....|.:..|..             ::...
  Fly   371 ATANLLFEHLCSHEEDRQPDD---YLRRALMSGFLLRILQKSLYFGRRKTEGVNPTAVELQVATA 432

  Fly   185 VVGVLEVNAFEAR---------------SPKGYPLRCLFPYTGILAHNCVPNTSRSIYPSEGYKI 234
            ::|:|:|..:.|.               |...|....|:.......|.|.|:|:....   |.|:
  Fly   433 LLGLLQVLQYNAHQIYQTQVTEEHRFDGSKTVYLAAGLYGTGSYFNHECWPSTACHFV---GKKL 494

  Fly   235 RLRAMVDLEEGQPLHHSY--TYTLDGTAQRQKHLKQGKFFTCQCERC------LDPTELGTHF-- 289
            .|.|.......:.:..:|  .:..:...:||:.|:....|:|.|..|      |...:....|  
  Fly   495 VLTATRPHRANELVAVNYGPIFIKNNLKERQRSLRGRYSFSCSCMACQENWPLLQKLDKQVRFWC 559

  Fly   290 SSLKCGQCAEGFQVPRQPTEPDTSWNCANCGSDTSNADALAMLQSLQSEVNAVQALPMAAKRLEE 354
            :|..|.      .:.:.|.:......|..|..:.|..:::|.:..::...........|.|.:|.
  Fly   560 TSANCS------NLLKFPKDLAKDVRCPRCRKNISLKESVAKMIKIEELYREAARAMEAQKTVEA 618

  Fly   355 IE 356
            ||
  Fly   619 IE 620

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-3NP_001260366.1 SET <207..252 CDD:250181 9/44 (20%)
Smyd4-2NP_648574.1 TPR_11 142..205 CDD:290150
zf-MYND 299..338 CDD:280009 11/52 (21%)
SET <474..513 CDD:279228 8/41 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.