DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-3 and Smyd4-4

DIOPT Version :9

Sequence 1:NP_001260366.1 Gene:SmydA-3 / 34502 FlyBaseID:FBgn0262599 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_610730.1 Gene:Smyd4-4 / 36299 FlyBaseID:FBgn0027495 Length:573 Species:Drosophila melanogaster


Alignment Length:435 Identity:93/435 - (21%)
Similarity:156/435 - (35%) Gaps:140/435 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LSVNRTAVQWSPVCGRYLVAKGAIRGHGLLIEELPFAVGPKCNGPVV------CLGCYEPN---P 62
            |.:..||.:     ||::|....:....|:..|.||     |:..:.      |..|...|   .
  Fly   187 LELRETAAE-----GRFVVTNRDLAVGDLVSVEEPF-----CSTLLTPMRYIRCATCKRENYLTL 241

  Fly    63 DPEEELCSECGWPLC-VECAQQADNAHFRLECSQLKDARARFFRLPSGSRHCPQLDCIMPLRVLL 126
            .|.:..||..   .| .||...|...:.|.|| .:.|...|.|.         ::.||.....|:
  Fly   242 IPCDSCCSTM---FCSEECKSIAMQTYHRYEC-PIIDFLNRMFN---------KIHCIALRTTLV 293

  Fly   127 A---------------KEANPER--WD---NEVAPMEHHK--------EERQRDADVWHADRV-- 161
            |               :|.|.::  :|   ||:.|.||::        :..:..:|::....|  
  Fly   294 ALNIFPSIEELIDFCEQEQNQDKCAFDLNYNELTPEEHYRAIHGLVTNQHLRSVSDLFQRSVVCA 358

  Fly   162 ----------NIAQYLRGPCQLANRFSEELI---------MQVVGVLE-VNAFEARSPKGYPLRC 206
                      .:.:||.|. :..|.|::.|.         |..:.::| ||  |.:..:.:....
  Fly   359 VLKHFIIEYTPVKEYLGGE-EGVNFFTDLLFRHLQTSPSNMHGIDLVEQVN--ETKDDQTHSSGA 420

  Fly   207 LFPYTGILAHNCVPNTSRSIYPSEGYKIRLRAMVDLEEGQPLHHSY--TYTLDGTAQRQKHLKQG 269
             :.:..::.|:|.|||.| ||  ||.|..:..:..::.|..|:.:|  .:.:....||.|.|...
  Fly   421 -YAFLSLINHSCAPNTVR-IY--EGTKAYMFVLRPIKAGNVLYDNYGAHFAICSKEQRLKRLSLQ 481

  Fly   270 KFFTCQCERCLDPTELGTHFSSLKCGQCAEGFQVPRQPTEP----DT-----SWN----CAN--- 318
            ..|.|:||.|    ||......:          :|.:.|.|    ||     |:|    .:|   
  Fly   482 YRFDCKCEGC----ELNYPMFGM----------MPHKATVPSVTDDTELALSSYNYDFAVSNYRK 532

  Fly   319 -------------CGSDTSNADALAMLQSLQSEVNAVQALPMAAK 350
                         |...:|..:.|.|...:.::     |:|:.||
  Fly   533 YCDFLTQYGDDYPCEQISSAEECLKMALHIMAD-----AVPLKAK 572

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-3NP_001260366.1 SET <207..252 CDD:250181 13/44 (30%)
Smyd4-4NP_610730.1 TPR_11 67..138 CDD:290150
zf-MYND 230..270 CDD:280009 11/42 (26%)
SET 363..463 CDD:279228 24/106 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.