DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-3 and set5

DIOPT Version :9

Sequence 1:NP_001260366.1 Gene:SmydA-3 / 34502 FlyBaseID:FBgn0262599 Length:507 Species:Drosophila melanogaster
Sequence 2:NP_588413.1 Gene:set5 / 2538853 PomBaseID:SPCC1739.05 Length:319 Species:Schizosaccharomyces pombe


Alignment Length:331 Identity:60/331 - (18%)
Similarity:96/331 - (29%) Gaps:156/331 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly   186 VGVLEVNAFEARSPKGYPLRCLFPYTGILAHNCVPNTSRSIYPSEGYKIRLRAMVDLEEGQ---- 246
            :|....||......||    .:|.....:.|:|.||...:..|... ::.:.|:.|:|.|:    
pombe    79 LGPFYSNALTIDETKG----GMFLLGSRMNHDCSPNVKHTWNPRLD-QVTVHAVRDIEAGEEILT 138

  Fly   247 ---PLHHSYTYTLDGTAQRQKHLKQGKFFTCQCERCLDPTELGTHFSSLKCGQCAEGFQVPRQPT 308
               .||.|:|       :|||.|.:...|.|.|..|                             
pombe   139 TYIDLHKSHT-------ERQKILLEHFGFKCYCSVC----------------------------- 167

  Fly   309 EPDTSWNCANCGSDTSNADALAMLQSLQSEVNAVQALPMAAKRLEEIERLLRKYKSLLHPLHFIA 373
                                            :|:            ||.:||           .
pombe   168 --------------------------------SVE------------ERKIRK-----------I 177

  Fly   374 TGLRQLLIEMYGRVQGYEMVQLPDHQLERKAELC----RQVLRVLNTFEPGLSRTRAMNLYELHV 434
            :.||:..:..|.|..               |::|    |..||.|.              :.:|:
pombe   178 SDLRRKQLAYYDRTM---------------AKMCIVNPRGALRALR--------------HRIHI 213

  Fly   435 PLVLLAKSGFIAGKLKGGELRARLVDAIDLLKECVEILEFEDKSSQEGVLCVVAKQALKQLTLSV 499
                 |....:.|:|.       ::..:|..:.||...:||..|       :.||:..|.::| .
pombe   214 -----AHEELLFGRLD-------IIALLDAFRLCVIHGDFERAS-------IFAKKGTKAISL-Y 258

  Fly   500 EGLGSE 505
            ||..||
pombe   259 EGTDSE 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-3NP_001260366.1 SET <207..252 CDD:250181 12/51 (24%)
set5NP_588413.1 SET <1..319 CDD:225491 60/331 (18%)
SET 4..147 CDD:214614 17/72 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG2084
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.