DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-3 and smyd2

DIOPT Version :9

Sequence 1:NP_001260366.1 Gene:SmydA-3 / 34502 FlyBaseID:FBgn0262599 Length:507 Species:Drosophila melanogaster
Sequence 2:XP_002934751.2 Gene:smyd2 / 100495522 XenbaseID:XB-GENE-985583 Length:430 Species:Xenopus tropicalis


Alignment Length:294 Identity:65/294 - (22%)
Similarity:102/294 - (34%) Gaps:72/294 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 RGHGLLIEELPFAVGP---KCNGPVV------------CLGCYEPNPDPEEELCSECGWPLC--- 77
            :|.||.... |||:|.   .|  |..            |..|:     ..:|..|:||  .|   
 Frog    15 KGRGLKATR-PFALGELLFSC--PAYTYVLTVNERGNHCEFCF-----ARKEGLSKCG--KCKQA 69

  Fly    78 ----VECAQQADNAHFRLECSQLKDARARFFRLPSGSRHCPQLDCIMPLRVLLAKEANPERWDNE 138
                |:| |:.|....:||||.:         ...|...||.....:..|:|..::...||..:|
 Frog    70 FYCNVDC-QKGDWPMHKLECSAM---------CTYGQNWCPSETVRLTARILAKQKTQTERTASE 124

  Fly   139 ----VAPMEHHKEERQRDADVWHADRVNIAQYLRGPCQLANRFSEELIMQVVGVLEVNAFEARSP 199
                |...|.|..:...:.          .:.::......:||..:.:.......:|..|...:.
 Frog   125 RFLSVKDFESHLSKLDNEK----------LELIQNDIAALHRFYSKNLHYSDNAAQVFLFAQVNC 179

  Fly   200 KGYPLR---------CLFPYTGILAHNCVPNTSRSIYPSEGYKIRLRAMVDLEEGQPLHHSYTYT 255
            .|:.:.         .:||...::.|:|.||.   |...:|....:||:.::..|..:..||...
 Frog   180 NGFTIEDEELSHLGSAIFPDVALMNHSCCPNV---IVTYKGTVAEVRAVQEIHAGDEVFTSYIDL 241

  Fly   256 LDGTAQRQKHLKQGKFFTCQCERC----LDPTEL 285
            |..|..|...|....||.|.|..|    .||.:|
 Frog   242 LYPTEDRNDRLIDSYFFNCDCRECSTKQKDPAKL 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-3NP_001260366.1 SET <207..252 CDD:250181 11/44 (25%)
smyd2XP_002934751.2 zf-MYND 50..88 CDD:280009 12/45 (27%)
SET 145..238 CDD:279228 16/95 (17%)
TPR_12 336..409 CDD:290160
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.