DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment SmydA-3 and smyd1

DIOPT Version :9

Sequence 1:NP_001260366.1 Gene:SmydA-3 / 34502 FlyBaseID:FBgn0262599 Length:507 Species:Drosophila melanogaster
Sequence 2:XP_012811600.1 Gene:smyd1 / 100145429 XenbaseID:XB-GENE-978314 Length:491 Species:Xenopus tropicalis


Alignment Length:411 Identity:86/411 - (20%)
Similarity:158/411 - (38%) Gaps:98/411 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 VCLGCYEPNPDPEEEL--CSECGWP-LCVECAQQADNAHFRLECSQLKDARARFFRLPSGSRHCP 114
            ||..|::    .:|:|  |.:|.:. .|....|:...|:.:.||..:|.|           ...|
 Frog    46 VCHSCFK----RQEKLLRCGQCKFAHYCDRTCQKESWANHKNECVAIKKA-----------GKAP 95

  Fly   115 QLDCIMPLRVL--LAKEAN--PERWDNEVAPMEHH------------KEERQRDADVWHADRVNI 163
            ..:..:..|:|  :.:|.:  .|.....:..:::|            .|:.|:..:.|       
 Frog    96 NENIRLAARILWRIEREGSGLTEGCLVSIDDLQNHIDKFDEAEKGLLMEDVQKFLEYW------- 153

  Fly   164 AQYLRGPCQLANRFSEELIMQVVGVLEVNAFEARSPKGYPLRC----LFPYTGILAHNCVPNTS- 223
                  |.| :.:|..:.|..:..|:..|.|.....:|  |:.    :||...:..|:|.||.: 
 Frog   154 ------PSQ-SQQFGMQYISHIFSVISCNGFTLSDQRG--LQAVGVGIFPNLCLANHDCWPNCTV 209

  Fly   224 ----------RSIYPSEGYKIRLRAMVDLEEGQPLHHSYTYTLDGTAQRQKHLKQGKFFTCQCER 278
                      ||::.:: .:|.|||:..:.:|:.|..||...|:.|..|:..||:..:|.|.||.
 Frog   210 IFNNGNHEAVRSMFHTQ-MRIELRALGKINKGEELTVSYVDFLNLTEDRKAQLKKQYYFDCTCEH 273

  Fly   279 CLDPTELGTHFSSLKCGQCAEGFQVPRQPTEPDTSWNCANCGSDTSNADALAMLQSLQSEVNAVQ 343
            |...|: .....::|.|:.....:|.::..:         ...||......|..:.|.::|  |:
 Frog   274 CTKKTK-DALLLAVKDGEDKPEERVVKEVIQ---------YSKDTMEKIEKARSEGLYNDV--VK 326

  Fly   344 ALPMAAKRLEEIERLLRKYKSLLHPLHFIATGLRQL-LIEMYGRVQGYEMVQLPDHQLERKAELC 407
            ......||.|.|               |..|.:..| ::.:|..|..|  :|:.|...|...::.
 Frog   327 LCRDCLKRQEPI---------------FADTNIYMLRILSIYSEVLSY--LQMFDDAAENAKKMV 374

  Fly   408 RQVLRVL--NTFEPGLSRTRA 426
            ...|::.  |..:.|::..||
 Frog   375 DGYLKIYHQNNAQLGMAVMRA 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
SmydA-3NP_001260366.1 SET <207..252 CDD:250181 14/55 (25%)
smyd1XP_012811600.1 zf-MYND 47..85 CDD:280009 9/41 (22%)
SET <189..252 CDD:214614 16/63 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D981799at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.