DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment porin and AT5G37610

DIOPT Version :9

Sequence 1:NP_001033899.1 Gene:porin / 34500 FlyBaseID:FBgn0004363 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_198577.1 Gene:AT5G37610 / 833739 AraportID:AT5G37610 Length:163 Species:Arabidopsis thaliana


Alignment Length:150 Identity:35/150 - (23%)
Similarity:65/150 - (43%) Gaps:8/150 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly   135 PLINASAVLGYQGWLAGYQTAFDTQQSKLTTNNFALGYTTKDFVLHTAVN-DGQEFSGSIFQRTS 198
            |:::.|||.|...|..|::...|.....:|..|..|...|:|.....::: ....|:.|.:||..
plant    18 PILSFSAVFGNDFWRFGFELTLDLVNRIITKANTVLSLITEDTTTTFSIDKKASLFTASYYQRLH 82

  Fly   199 DKLDVGVQLSWASGTSNTKFAIGAKYQLDDDASVRA--KVNNASQVGLGYQQKLRDGVTL-TLST 260
            .|...|.:..:.....:..|:||.::...||..::|  .|:|...:.:.:|...    || :..|
plant    83 SKTVCGAEAKYILSDKSNSFSIGKRHLFGDDDLIQALLSVSNGGSMRVLFQHHW----TLKSFFT 143

  Fly   261 LVDGKNFNAGGHKIGVGLEL 280
            :...:..|....:.|:.:||
plant   144 IAGERLLNHSSQRFGLAVEL 163

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
porinNP_001033899.1 Porin3_VDAC 3..281 CDD:132767 34/149 (23%)
AT5G37610NP_198577.1 Porin3 <6..163 CDD:295739 33/148 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3126
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D938262at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.