DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment porin and CG17140

DIOPT Version :9

Sequence 1:NP_001033899.1 Gene:porin / 34500 FlyBaseID:FBgn0004363 Length:282 Species:Drosophila melanogaster
Sequence 2:NP_001033896.1 Gene:CG17140 / 3885616 FlyBaseID:FBgn0260453 Length:361 Species:Drosophila melanogaster


Alignment Length:284 Identity:77/284 - (27%)
Similarity:129/284 - (45%) Gaps:22/284 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 PSYSDLGKQARDIFSKGYNFGLWKLDLKTKTSSGIEFNTAGHSNQESGKVFGSLETKYKVKDYGL 68
            |:|..:|..|:|....|:..|.|::...|:|.:....||.|........|||.:|...:|.:|..
  Fly    83 PTYFHVGALAKDCLINGFKIGAWQMHCSTRTDNDFYLNTFGEGYPTMKNVFGGMEVFKEVGNYST 147

  Fly    69 TLTEKWNTDNTLFTEVAVQDQLLEGLKLS--LEGNFAPQSGNKNG---KFKVAYGHENVKADSDV 128
            :|  .|.|:|.|.:|:||:     |:...  |.|......|.|:.   :.|:..|.|.    ..|
  Fly   148 SL--GWFTNNDLLSEIAVR-----GMNFGSRLYGLLKSTIGTKDEVSFQTKLKCGLER----DPV 201

  Fly   129 NIDLKGPLINASAVLGY------QGWLAGYQTAFDTQQSKLTTNNFALGYTTKDFVLHTAVNDGQ 187
            .::|..||.|....|||      :.|:.||:|.::..:.....:...|||......:...:.:.:
  Fly   202 KVELVVPLYNEPLFLGYVLVAPVENWVLGYRTEYNFDEKGFDKHALCLGYNNGRTEVGLKLENFE 266

  Fly   188 EFSGSIFQRTSDKLDVGVQLSWASGTSNTKFAIGAKYQLDDDASVRAKVNNASQVGLGYQQKLRD 252
            :..||||||..:.....::.:..|..:..:||||.:|...:...|:||:...|::|..||.|:.:
  Fly   267 DLRGSIFQRIGEAWAFAIKTNLYSSENVKQFAIGVQYDFQNGTMVKAKLREDSRMGFVYQSKIGE 331

  Fly   253 GVTLTLSTLVDGKNFNAGGHKIGV 276
            .:.:......||.:...|.|:|||
  Fly   332 NIDVGYHLAFDGVDPIGGAHRIGV 355

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
porinNP_001033899.1 Porin3_VDAC 3..281 CDD:132767 77/284 (27%)
CG17140NP_001033896.1 Porin3_VDAC 82..360 CDD:132767 77/284 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45456956
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3126
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11743
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.