DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6700 and xmas

DIOPT Version :9

Sequence 1:NP_001162944.1 Gene:CG6700 / 34496 FlyBaseID:FBgn0032305 Length:874 Species:Drosophila melanogaster
Sequence 2:NP_001356948.1 Gene:xmas / 44271 FlyBaseID:FBgn0286809 Length:2079 Species:Drosophila melanogaster


Alignment Length:498 Identity:101/498 - (20%)
Similarity:192/498 - (38%) Gaps:116/498 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   450 KYSSKKRYSRSRSRSRSRSRSPRSRSCSRSSDASSPPARKIIRKSGSNESLNFIPLTANLSRKQQ 514
            ||.::..:.|..:......| ||..:|:.|..:....||.::..:.....|..|....|.:...|
  Fly    26 KYVARSHFGRFGTLVNFVLR-PRRMTCTVSYASEDEAARALLDGASFQGHLFDISYADNETAPAQ 89

  Fly   515 K-------------MLMKKGKRAAAMASAQMKKKDTPHFYSNQSS------VGGAVDD------- 553
            |             ..::.|.|....:...:||.......|..||      ||.|...       
  Fly    90 KTEEWVDPDIQAELSALQSGWRNEYGSGKPIKKPQNGSSGSGGSSMLPAIPVGPATAPVSRDRTP 154

  Fly   554 ----DTARLQQRAARFSQQGSS--SAKKSVVAIASSPFGLTTA---------KNKKKMVQQHQQH 603
                |...:.:|.|..|::..|  .|:..::.:..:...|:.|         ..|::::::.|  
  Fly   155 AQLRDLENMMRRPAHTSEEKFSVLDARDKLLRLNRTQHKLSGATQGHCADMCPEKERVLREFQ-- 217

  Fly   604 QRSAFYEDTEAASGIDLLDLHIVGTCRDLEKSFLRLTKA------PSPSEVR-------PVEVLT 655
            ::.|:|   |...|.|.|..|        |::..:.:::      |.|.|:|       .:..|.
  Fly   218 RQVAYY---ELQPGSDELICH--------ERALKQYSRSSADQETPLPHELRNETALHMTMSYLM 271

  Fly   656 HSLVNVK---------GKWRANQDYHYACDQLKSIRQDLTVQGIRDQFTVEVYETHARIAM---- 707
            |.::::.         |.|     :|:..|:.:|||:::|.|.:.....|::.|..||..:    
  Fly   272 HEIMDISERQDPQSHMGDW-----FHFVWDRTRSIRKEITQQELCSLGAVKLVEQCARFHIHCAA 331

  Fly   708 -----------EKGDHEEFNQCQTQLKMLYMEIGGKNA---NALEFTAYRILYYIFTKNTL-DIT 757
                       .|.:.|...:|...||.:|.::..|..   ...||..|.:|..:...|.| || 
  Fly   332 RLVDADPSVFDSKINAENLTKCLQTLKYMYHDLRIKGVPCPKEAEFRGYIVLLNLADANFLWDI- 395

  Fly   758 TVMRSITADQRENPVIAHALQFRSAWSLGNYCKLFSLYR---TAPLMSGHMIEWFLERERKAALR 819
               ..:.|:.:..|.:..|:||..|....|:.:.|.|..   |:.|.:..::.:| .|.|...|.
  Fly   396 ---GQLPAELQSCPEVRQAIQFYLALQDTNFVRFFQLLADKDTSYLSACILVNYF-TRLRVLGLH 456

  Fly   820 VIIKSYR-------PNISVDYITKILAFDSSEKCKEWLDTFSL 855
            .:|::||       .::.:.||.::|:|.|.::..:::..:.|
  Fly   457 RLIQAYRSPRKDEVSSLPLSYIAELLSFASEQEAADFVQHYGL 499

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6700NP_001162944.1 SAC3_GANP 643..840 CDD:281402 55/241 (23%)
xmasNP_001356948.1 RRM_XMAS2 12..82 CDD:240903 12/56 (21%)
SAC3_GANP 200..503 CDD:335312 68/323 (21%)
DUF5401 <638..>827 CDD:340095
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12436
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.