DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6700 and CG3437

DIOPT Version :9

Sequence 1:NP_001162944.1 Gene:CG6700 / 34496 FlyBaseID:FBgn0032305 Length:874 Species:Drosophila melanogaster
Sequence 2:NP_648318.2 Gene:CG3437 / 39096 FlyBaseID:FBgn0035998 Length:349 Species:Drosophila melanogaster


Alignment Length:282 Identity:56/282 - (19%)
Similarity:103/282 - (36%) Gaps:72/282 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   632 LEKSFLRL---TKAPSPSEVRPVEVLTHSL------VNVKGKWRANQDYHYACDQLKSIRQDLTV 687
            |.|.|.|.   .|.|.|.|:|....||.::      :.:..:...|..|.:..|:|:::|:::.:
  Fly    42 LVKEFTRSAADVKMPMPKEMRTEAALTKTVEYLLKDIILDTRKPYNVAYDFIFDRLRAVRREIVI 106

  Fly   688 QGIRDQFTVEVYETHARIAM--------------------EKGD----HEEFNQCQTQLKMLYME 728
            |         :|:...:|.:                    ||.|    ::...:|.|.:...|.|
  Fly   107 Q---------MYDASQKICLLEPIVMFLAYSRYRLCEEPIEKFDLKICNQHLQECLTGVLCCYEE 162

  Fly   729 IGGKNAN------ALEFTAY-RILYYIFTKNTLDITTVMRSITADQ--RENPVIAHALQFRSAWS 784
            :....::      .||...: ..||.:|...:.:..|  |::|...  |.:...........|:.
  Fly   163 LEDLESSREPTVRELERRCFIESLYQLFNLGSPESFT--RALTLPDYVRRDATFKLCFGICLAFQ 225

  Fly   785 LGNYCKLFSLYRTAPLMSGHMIEWFLERERKAALRVIIKSY-----------RPNISVDYITKIL 838
            .||      |||.  ||....:...|.....|.|:||.:|.           :..:.|.|:.::|
  Fly   226 QGN------LYRV--LMGVPQLPHILCAVAAAKLQVIRRSLLQIFTHAYNNKQLTVPVPYLLRLL 282

  Fly   839 AFDSSEKCKEWLDTFSLPYAAD 860
            .||.....::....:::...||
  Fly   283 LFDGPTGLQDQCRHYNISLTAD 304

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6700NP_001162944.1 SAC3_GANP 643..840 CDD:281402 47/246 (19%)
CG3437NP_648318.2 SAC3_GANP 56..284 CDD:281402 47/246 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45435242
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR12436
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.