DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nos and CG14882

DIOPT Version :9

Sequence 1:NP_523541.2 Gene:Nos / 34495 FlyBaseID:FBgn0011676 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_001262637.1 Gene:CG14882 / 41994 FlyBaseID:FBgn0038429 Length:454 Species:Drosophila melanogaster


Alignment Length:409 Identity:115/409 - (28%)
Similarity:195/409 - (47%) Gaps:41/409 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   935 LTRLSEGAKTTMLLEICAPG-LEYEPGDHVGIFPANRTELVDGLLNRLVGVDNPDEVLQLQLLKE 998
            |....:..:|..::|:.... .:|:|||.:||.|||:.|.|:.||:||..:|..|....|:|   
  Fly    67 LVSADKATETKRVVELTLESTFDYQPGDTIGILPANKLEQVESLLHRLELLDQADTTCHLKL--- 128

  Fly   999 KQTSNGIFKCWEPHDKIP-----PDTLRNLLARFFDLTTPPSRQLLTLLAGFCEDTADKERLEL- 1057
                  :|.|...:.|:|     ..|.|.:|.....|...|.:|||:.||||..|  ||||..| 
  Fly   129 ------VFNCANKNAKLPAHIPATTTPREILTHCLSLNFVPQKQLLSALAGFTSD--DKERCFLS 185

  Fly  1058 LVNDSSAYEDWRHWRLPH---LLDVLEEFPSCRPPAPLLLAQLTPLQPRFYSISSSPRRVSD-EI 1118
            .::...|.|.::...|..   .:|:||...:||||...|...|..|.||.|||::||...|: |:
  Fly   186 CLSSKQATEYYQSLILEQGLLFIDILEVCVNCRPPLAFLAEHLPRLLPRPYSIANSPLEASNREL 250

  Fly  1119 HLTVAIVKYRCEDGQGDERYGVCSNYL------SGLRADDELFMFVR-SALGFHLPSDRSRPIIL 1176
            .:..:::..         :.||.::.|      |......::.::.| |.|..:...|..|..||
  Fly   251 RVIYSLLSL---------KPGVTTSMLEAAAQQSSPEHSKKVVIYPRMSNLFRYTERDVGRNQIL 306

  Fly  1177 IGPGTGIAPFRSFWQEFQVLSDLDPTAKLPKMWLFFGCRNRDVDLYAEEKAELQKDQILDRVFLA 1241
            |..|||:|||..|....:.|....|.....:.||:.|.:..:..|..|:..|.|:..:|:|:.:.
  Fly   307 IAVGTGLAPFLGFLAHKEELIKQQPQQPSGQSWLYIGAKTPEAVLKREKLMEWQESSLLERLRMC 371

  Fly  1242 LSREQAIPKTYVQDLIEQEFDSLYQLIVQERGHIYVCGD-VTMAEHVYQTIRKCIAGKEQKSEAE 1305
            .||.::  .:|||.::|::.:.|.:.:::....:|:|.| ..:::.:...:.:|:......:|.|
  Fly   372 YSRGES--PSYVQHMLEEDCEDLVEFLMKSETVLYICADGAKISQSIAGVLSRCLQKAMHLTEEE 434

  Fly  1306 VETFLLTLRDESRYHEDIF 1324
            ....|..||.:.:|.||::
  Fly   435 ASQLLKKLRKQDKYREDVW 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NosNP_523541.2 NOS_oxygenase_euk 216..624 CDD:238410
CysJ 669..1323 CDD:223446 114/406 (28%)
Flavodoxin_1 673..863 CDD:278677
Nitric_oxide_synthase 931..1328 CDD:99799 115/409 (28%)
CG14882NP_001262637.1 methionine_synthase_red 66..453 CDD:99800 115/407 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439819
Domainoid 1 1.000 52 1.000 Domainoid score I664
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.840

Return to query results.
Submit another query.