DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nos and bcd

DIOPT Version :9

Sequence 1:NP_523541.2 Gene:Nos / 34495 FlyBaseID:FBgn0011676 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_788587.1 Gene:bcd / 40830 FlyBaseID:FBgn0000166 Length:494 Species:Drosophila melanogaster


Alignment Length:249 Identity:61/249 - (24%)
Similarity:88/249 - (35%) Gaps:81/249 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 STNA------QQQQ---QQQQ---------QQLQQQQQQLQQQK-----AQTQQQNSRKIKTQAT 61
            |||.      ||||   .|||         .|:||||||.|||:     .|.:|.::.::..:..
  Fly   251 STNVNGGQFFQQQQVHNHQQQLHHQGNHVPHQMQQQQQQAQQQQYHHFDFQQKQASACRVLVKDE 315

  Fly    62 PTLNGN---------GLLSGNPNGGG---GDSSPSHEVDHP----------------GG----AQ 94
            |..:.|         |:.....:...   |.:||..||..|                ||    |.
  Fly   316 PEADYNFNSSYYMRSGMSGATASASAVARGAASPGSEVYEPLTPKNDESPSLCGIGIGGPCAIAV 380

  Fly    95 G-AQAAGGLPSSSGTPLRHHKRASISTASPPIRERRGTNTSIVVELDGSGSG--------SGSGG 150
            | .:||..:  ..||    .|:.::....|    .:|.:.|..   |||...        :|:|.
  Fly   381 GETEAADDM--DDGT----SKKTTLQILEP----LKGLDKSCD---DGSSDDMSTGIRALAGTGN 432

  Fly   151 GGVGVGQ-GAGCPPSGSCTASGKSSRELSPSPKNQQQPRKMSQDY---RSRAGS 200
            .|....: |...||.|.....|.....:..|.:.|.....:.|.|   |:.||:
  Fly   433 RGAAFAKFGKPSPPQGPQPPLGMGGVAMGESNQYQCTMDTIMQAYNPHRNAAGN 486

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NosNP_523541.2 NOS_oxygenase_euk 216..624 CDD:238410
CysJ 669..1323 CDD:223446
Flavodoxin_1 673..863 CDD:278677
Nitric_oxide_synthase 931..1328 CDD:99799
bcdNP_788587.1 Homeobox 106..153 CDD:278475
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.75 Normalized mean entropy S1636
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.