DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Nos and mei-2

DIOPT Version :9

Sequence 1:NP_523541.2 Gene:Nos / 34495 FlyBaseID:FBgn0011676 Length:1349 Species:Drosophila melanogaster
Sequence 2:NP_491894.1 Gene:mei-2 / 172374 WormBaseID:WBGene00003184 Length:280 Species:Caenorhabditis elegans


Alignment Length:291 Identity:60/291 - (20%)
Similarity:104/291 - (35%) Gaps:96/291 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   749 SSEHGLQD----SSIGSSKS-------FMKASSRQEFMKLPL--QQVKRIDRWDSLRGSTSDTFT 800
            ||..|.:.    :.||||::       |....||:     ||  :..|.:.|....||....:..
 Worm    36 SSRRGAEKDVPITFIGSSRTVKADLPEFTNTRSRR-----PLHSESKKELSRNPVSRGEEHSSSL 95

  Fly   801 EETFGPLSNVRFAVFALGSSAYPNFCAFGQYVDNILGELGGERLLRVAYGDEMCGQEQSFRKWAP 865
                 |.|:...:|..:.|:| ..:.|..:.|:.|                .:|.:.:|...   
 Worm    96 -----PKSSPESSVSVMSSNA-SLWSACTEEVNKI----------------GVCAKRESRNL--- 135

  Fly   866 EVFKLACETFCLDPEESLSDASLALQNDSLTVNTVRLVPSANKGSLDSS-----------LSKYH 919
            .|:|:  ::|..:.|:.||:      ::.|....:|::.|.|...|:|.           .|..:
 Worm   136 RVYKM--KSFTSNMEQILSN------DNQLAPTVIRILNSRNSWCLNSCHACLTFIMENITSDNY 192

  Fly   920 NKKVHCCKAKAKPHNLTRLSEGAKTTMLLEICAPGLEYEPGDHVGIFPANRTELVDGLLNRLVGV 984
            .|:..|.||.|           :.|..||:..           :| |.:.:|        |.:||
 Worm   193 GKRSACLKALA-----------SITNSLLDTI-----------IG-FASTKT--------RRIGV 226

  Fly   985 DNPDEVLQLQLLKEKQTSNGIFKCWEPHDKI 1015
               |.|.:.:..|..:..:...|..:..|||
 Worm   227 ---DVVAEERAAKATECIHNFRKIVKNRDKI 254

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
NosNP_523541.2 NOS_oxygenase_euk 216..624 CDD:238410
CysJ 669..1323 CDD:223446 60/291 (21%)
Flavodoxin_1 673..863 CDD:278677 26/126 (21%)
Nitric_oxide_synthase 931..1328 CDD:99799 16/85 (19%)
mei-2NP_491894.1 Katanin_con80 <161..253 CDD:290636 24/125 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0.75 Normalized mean entropy S1636
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.