Sequence 1: | NP_609458.1 | Gene: | CG17134 / 34494 | FlyBaseID: | FBgn0032304 | Length: | 391 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_076890.1 | Gene: | YGL258W-A / 852633 | SGDID: | S000007607 | Length: | 77 | Species: | Saccharomyces cerevisiae |
Alignment Length: | 72 | Identity: | 22/72 - (30%) |
---|---|---|---|
Similarity: | 34/72 - (47%) | Gaps: | 8/72 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 207 QGLLDEPVISFYLKRQGTAVRGGELILGGIDSSLYRGSLTYVPVSVPAYWQFKVNTIKTNGTLLC 271
Fly 272 NGCQAIA 278 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG17134 | NP_609458.1 | pepsin_retropepsin_like | 70..386 | CDD:299705 | 22/72 (31%) |
Asp | 75..388 | CDD:278455 | 22/72 (31%) | ||
YGL258W-A | NP_076890.1 | pepsin_retropepsin_like | <6..>74 | CDD:416259 | 22/72 (31%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E1_KOG1339 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 1 | 1.000 | - | - | FOG0000066 | |
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.900 |