DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17134 and YPS5

DIOPT Version :9

Sequence 1:NP_609458.1 Gene:CG17134 / 34494 FlyBaseID:FBgn0032304 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_011255.1 Gene:YPS5 / 852632 SGDID:S000003228 Length:165 Species:Saccharomyces cerevisiae


Alignment Length:147 Identity:35/147 - (23%)
Similarity:58/147 - (39%) Gaps:28/147 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    37 SVKAEKTVLASKYS----FLAETSFSVSSSGA---------TENLHNSMNN---EYYGVIAIGTP 85
            |:....|||.|..|    |..:....:.:.|.         .|.|:.::.|   .|...:.||||
Yeast    12 SLMCSLTVLGSSASSYVKFPVQKFADIINIGTQDVSTVFKRNEVLNTTVINGIGVYVVKMEIGTP 76

  Fly    86 EQRFNILFDTGSANLWVPSASCPASNTACQRHNKYDSSASSTYVANGEEFAIEYGTGSLSGFLSN 150
            .|...:..||||:::.|        |.|...:.|..|..|.....:..|....: ||..|...|.
Yeast    77 PQTVYLQLDTGSSDMIV--------NNADIAYCKSMSDGSDYASTDNYELTATF-TGPRSTTTSP 132

  Fly   151 DIVTIA---GISIQNQT 164
            :::|::   |::...:|
Yeast   133 ELITLSALIGVNSMQET 149

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17134NP_609458.1 pepsin_retropepsin_like 70..386 CDD:299705 25/101 (25%)
Asp 75..388 CDD:278455 24/93 (26%)
YPS5NP_011255.1 pepsin_retropepsin_like 65..>100 CDD:416259 13/42 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.