DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17134 and YPS3

DIOPT Version :9

Sequence 1:NP_609458.1 Gene:CG17134 / 34494 FlyBaseID:FBgn0032304 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_013222.1 Gene:YPS3 / 850812 SGDID:S000004111 Length:508 Species:Saccharomyces cerevisiae


Alignment Length:381 Identity:104/381 - (27%)
Similarity:156/381 - (40%) Gaps:71/381 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    41 EKTVLASKYSFLAETSFSVSSSGATENLHNSMNNEYYGVIAIGTPEQRFNILFDTGSANLWVPSA 105
            ||.|||::.||     :||.                   :|||||.|...:|.|||||:||||..
Yeast    52 EKFVLANEQSF-----YSVE-------------------LAIGTPSQNLTVLLDTGSADLWVPGK 92

  Fly   106 SCP--ASNTACQRHNKYDSSASSTYVAN-GEEFAIEYGTGSLS-GFLSNDIVTIAGISIQNQTFG 166
            ..|  .|...|.::..:|.:.|||:.|| ...|...||.|:.: |....|.:....:.:...:|.
Yeast    93 GNPYCGSVMDCDQYGVFDKTKSSTFKANKSSPFYAAYGDGTYAEGAFGQDKLKYNELDLSGLSFA 157

  Fly   167 EALSEPGTTFVDAPFAGILGLAFSAIAV---------DGVTPPFDN----MISQGLLDEPVISFY 218
            .| :|..:||      |:||:..|.:.|         |..:..:||    :...|.:|....|.:
Yeast   158 VA-NESNSTF------GVLGIGLSTLEVTYSGKVAIMDKRSYEYDNFPLFLKHSGAIDATAYSLF 215

  Fly   219 LKRQGTAVRGGELILGGIDSSLYRGSLTYVPVSVPAY----WQFKV-----------NTIKTNGT 268
            |..:..:  .|.::.|.:|.|.|.|.|..:|: |..|    :|..|           .|.|.|.|
Yeast   216 LNDESQS--SGSILFGAVDHSKYEGQLYTIPL-VNLYKSQGYQHPVAFDVTLQGLGLQTDKRNIT 277

  Fly   269 LLCNGCQAIADTGTSLIAVPLAAYRKINRQLGATDND--GEAFVRCGRVSSLPKVNLNIGGTVFT 331
            |......|:.|:||:|..:|..|...:.:.|.|:.:.  |.....|....:...|..:.||....
Yeast   278 LTTTKLPALLDSGTTLTYLPSQAVALLAKSLNASYSKTLGYYEYTCPSSDNKTSVAFDFGGFRIN 342

  Fly   332 LAPRDYIVKVTQNGQTYCMSAFTYMEGLSFWILGDVFIGKFYTVFDKGNERIGFAR 387
            ....|:.:   |.....|:.|.....|.:..||||.|:...|.|:|..|..|..|:
Yeast   343 APLSDFTM---QTSVGTCVLAIIPQAGNATAILGDSFLRNAYVVYDLDNYEISLAQ 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17134NP_609458.1 pepsin_retropepsin_like 70..386 CDD:299705 94/349 (27%)
Asp 75..388 CDD:278455 95/347 (27%)
YPS3NP_013222.1 SAP_like 61..396 CDD:133141 99/372 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.