DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17134 and AT5G48430

DIOPT Version :9

Sequence 1:NP_609458.1 Gene:CG17134 / 34494 FlyBaseID:FBgn0032304 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_199654.1 Gene:AT5G48430 / 834898 AraportID:AT5G48430 Length:406 Species:Arabidopsis thaliana


Alignment Length:463 Identity:97/463 - (20%)
Similarity:158/463 - (34%) Gaps:154/463 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 RQLLVLLVLVGIGHSAAKLNRVQLQVNKNFTKTHGSVKAEKTVLASKYSFLAETSFSVSSSGATE 66
            :.||||.:::...:|         .|:.|:......|..     .||.:.|...:|::::     
plant     3 KSLLVLCLILFFTYS---------YVSANYYPPKALVST-----VSKNTILPIFTFTLNT----- 48

  Fly    67 NLHNSMNNEYYGVIAIGTPEQRFNILFDTGSANLWVPSASCPASNTAC---QRHNKYDSSASSTY 128
                  |.|::  |.||.|       :.....|..:|....|..:..|   :|...:..|..|..
plant    49 ------NQEFF--IHIGGP-------YLVRKCNDGLPRPIVPCGSPVCALTRRFTPHQCSLPSNK 98

  Fly   129 VANG---------EEF-------AIEYGTGSLSGF--LSNDIVTIAGISIQNQTFGEALSEPGTT 175
            :.||         |.|       ...||..|:|..  :|      ..::|.|..:   |..|...
plant    99 IINGVCACQATAFEPFQRICNSDQFTYGDLSISSLKPIS------PSVTINNVYY---LCIPQPF 154

  Fly   176 FVDAP--FAGILGLAFSAIAV-DGVTPPFDNMISQGLLDEPVISFYLKRQGTAVRGGELILGGID 237
            .||.|  ..|:.|||.:|:|. :.:|.|...:..:..|..|.....||:......||...|..||
plant   155 LVDFPPGVFGLAGLAPTALATWNQLTRPRLGLEKKFALCLPSDENPLKKGAIYFGGGPYKLRNID 219

  Fly   238 SSLYRGSLTYVPVSVPAYWQFKVNTIKTNGTLLCNGCQAIADTGTSLIAVPLAAYRKINRQLGAT 302
            :.           |:.:|.:...|..|.|...|  |.:.|:..|..::..|.|.         |.
plant   220 AR-----------SMLSYTRLITNPRKLNNYFL--GLKGISVNGNRILFAPNAF---------AF 262

  Fly   303 DNDG------------------------EAFVRC----GRVSS---------------LPKVNLN 324
            |.:|                        |||.:.    .||||               :|:::|.
plant   263 DRNGDGGVTLSTIFPFTMLRSDIYRVFIEAFSQATSGIPRVSSTTPFEFCLSTTTNFQVPRIDLE 327

  Fly   325 I-GGTVFTLAPRDYIVKVTQNGQTYCMSAFTYMEGLSFWILGD-----VFIG-----KFYTVFDK 378
            : .|.::.|:|.:.:.||:.:     ::...::.|      ||     |.||     .....||.
plant   328 LANGVIWKLSPANAMKKVSDD-----VACLAFVNG------GDAAAQAVMIGIHQMENTLVEFDV 381

  Fly   379 GNERIGFA 386
            |....||:
plant   382 GRSAFGFS 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17134NP_609458.1 pepsin_retropepsin_like 70..386 CDD:299705 84/393 (21%)
Asp 75..388 CDD:278455 84/390 (22%)
AT5G48430NP_199654.1 xylanase_inhibitor_I_like 36..392 CDD:133156 87/416 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.