DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17134 and PGA4

DIOPT Version :9

Sequence 1:NP_609458.1 Gene:CG17134 / 34494 FlyBaseID:FBgn0032304 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001073276.1 Gene:PGA4 / 643847 HGNCID:8886 Length:388 Species:Homo sapiens


Alignment Length:403 Identity:168/403 - (41%)
Similarity:231/403 - (57%) Gaps:36/403 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 LVLLVLVGIGHSAAKLNRVQLQVNKNFTKTHGSVKAEKTVL-----------ASKYSFLAETSFS 58
            |:||.||.:  |...:.:|.|...|:..:|    .:|:.:|           |.||....|....
Human     4 LLLLGLVAL--SECIMYKVPLIRKKSLRRT----LSERGLLKDFLKKHNLNPARKYFPQWEAPTL 62

  Fly    59 VSSSGATENLHNSMNNEYYGVIAIGTPEQRFNILFDTGSANLWVPSASCPASNTACQRHNKYDSS 123
            |..    :.|.|.::.||:|.|.||||.|.|.::|||||:||||||..|  |:.||..||:::..
Human    63 VDE----QPLENYLDMEYFGTIGIGTPAQDFTVVFDTGSSNLWVPSVYC--SSLACTNHNRFNPE 121

  Fly   124 ASSTYVANGEEFAIEYGTGSLSGFLSNDIVTIAGISIQNQTFGEALSEPGTTFVDAPFAGILGLA 188
            .||||.:..|..:|.|||||::|.|..|.|.:.|||..||.||.:.:|||:....|||.||||||
Human   122 DSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGISDTNQIFGLSETEPGSFLYYAPFDGILGLA 186

  Fly   189 FSAIAVDGVTPPFDNMISQGLLDEPVISFYLKRQGTAVRGGELILGGIDSSLYRGSLTYVPVSVP 253
            :.:|:..|.||.|||:.:|||:.:.:.|.||.....:  |..:|.||||||.|.|||.:|||:|.
Human   187 YPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADDQS--GSVVIFGGIDSSYYTGSLNWVPVTVE 249

  Fly   254 AYWQFKVNTIKTNG-TLLC-NGCQAIADTGTSLIAVPLAAYRKINRQLGATDN-DGEAFVRCGRV 315
            .|||..|::|..|| .:.| .|||||.||||||:..|.:....|...:||::| ||:..|.|..:
Human   250 GYWQITVDSITMNGEAIACAEGCQAIVDTGTSLLTGPTSPIANIQSDIGASENSDGDMVVSCSAI 314

  Fly   316 SSLPKVNLNIGGTVFTLAPRDYIVKVTQNGQTYCMSAFTYM----EGLSFWILGDVFIGKFYTVF 376
            ||||.:...|.|..:.:.|..||::    .:..|:|.|..|    |....||||||||.:::|||
Human   315 SSLPDIVFTINGVQYPVPPSAYILQ----SEGSCISGFQGMNLPTESGELWILGDVFIRQYFTVF 375

  Fly   377 DKGNERIGFARVA 389
            |:.|.::|.|.||
Human   376 DRANNQVGLAPVA 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17134NP_609458.1 pepsin_retropepsin_like 70..386 CDD:299705 147/322 (46%)
Asp 75..388 CDD:278455 147/319 (46%)
PGA4NP_001073276.1 A1_Propeptide 17..45 CDD:311771 6/31 (19%)
pepsin_A 66..386 CDD:133145 148/327 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151451
Domainoid 1 1.000 297 1.000 Domainoid score I1463
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 319 1.000 Inparanoid score I2536
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 1 1.000 - - mtm8487
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1456
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.