DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17134 and PGA3

DIOPT Version :9

Sequence 1:NP_609458.1 Gene:CG17134 / 34494 FlyBaseID:FBgn0032304 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001073275.1 Gene:PGA3 / 643834 HGNCID:8885 Length:388 Species:Homo sapiens


Alignment Length:368 Identity:159/368 - (43%)
Similarity:215/368 - (58%) Gaps:25/368 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 KNFTKTHGSVKAEKTVLASKYSFLAETSFSVSSSGATENLHNSMNNEYYGVIAIGTPEQRFNILF 93
            |:|.|.|....|.|.....|...|.:          .:.|.|.::.||:|.|.||||.|.|.::|
Human    39 KDFLKKHNLNPARKYFPQWKAPTLVD----------EQPLENYLDMEYFGTIGIGTPAQDFTVVF 93

  Fly    94 DTGSANLWVPSASCPASNTACQRHNKYDSSASSTYVANGEEFAIEYGTGSLSGFLSNDIVTIAGI 158
            ||||:||||||..|  |:.||..||:::...||||.:..|..:|.|||||::|.|..|.|.:.||
Human    94 DTGSSNLWVPSVYC--SSLACTNHNRFNPEDSSTYQSTSETVSITYGTGSMTGILGYDTVQVGGI 156

  Fly   159 SIQNQTFGEALSEPGTTFVDAPFAGILGLAFSAIAVDGVTPPFDNMISQGLLDEPVISFYLKRQG 223
            |..||.||.:.:|||:....|||.||||||:.:|:..|.||.|||:.:|||:.:.:.|.||....
Human   157 SDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQGLVSQDLFSVYLSADD 221

  Fly   224 TAVRGGELILGGIDSSLYRGSLTYVPVSVPAYWQFKVNTIKTNG-TLLC-NGCQAIADTGTSLIA 286
            .:  |..:|.||||||.|.|||.:|||:|..|||..|::|..|| .:.| .|||||.||||||:.
Human   222 QS--GSVVIFGGIDSSYYTGSLNWVPVTVEGYWQITVDSITMNGEAIACAEGCQAIVDTGTSLLT 284

  Fly   287 VPLAAYRKINRQLGATDN-DGEAFVRCGRVSSLPKVNLNIGGTVFTLAPRDYIVKVTQNGQTYCM 350
            .|.:....|...:||::| ||:..|.|..:||||.:...|.|..:.:.|..||::    .:..|:
Human   285 GPTSPIANIQSDIGASENSDGDMVVSCSAISSLPDIVFTINGVQYPVPPSAYILQ----SEGSCI 345

  Fly   351 SAFTYM----EGLSFWILGDVFIGKFYTVFDKGNERIGFARVA 389
            |.|..|    |....||||||||.:::||||:.|.::|.|.||
Human   346 SGFQGMNLPTESGELWILGDVFIRQYFTVFDRANNQVGLAPVA 388

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17134NP_609458.1 pepsin_retropepsin_like 70..386 CDD:299705 147/322 (46%)
Asp 75..388 CDD:278455 147/319 (46%)
PGA3NP_001073275.1 A1_Propeptide 17..45 CDD:285240 3/5 (60%)
pepsin_A 66..386 CDD:133145 148/327 (45%)
Asp 75..387 CDD:278455 147/319 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151450
Domainoid 1 1.000 297 1.000 Domainoid score I1463
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 319 1.000 Inparanoid score I2536
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 1 1.000 - - mtm8487
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1456
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1110.910

Return to query results.
Submit another query.