DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17134 and asp-19

DIOPT Version :9

Sequence 1:NP_609458.1 Gene:CG17134 / 34494 FlyBaseID:FBgn0032304 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001123079.1 Gene:asp-19 / 6418790 WormBaseID:WBGene00077655 Length:223 Species:Caenorhabditis elegans


Alignment Length:203 Identity:72/203 - (35%)
Similarity:107/203 - (52%) Gaps:20/203 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    70 NSMNNEYY-------GVIAIGTPEQRFNILFDTGSANLWVPSASCPASNTACQ-----RHNKYDS 122
            |...|.|:       |.|.||||.|..::..||.|||.||..:.|.::|  |.     |.:|:::
 Worm    26 NQQANRYFNFDDSCIGNITIGTPPQSASVFMDTTSANWWVIGSKCTSAN--CNGYSGIRKHKFNT 88

  Fly   123 SASSTYVANGEEFAIEYGTGSLSGFLSNDIVTIAGISIQNQTFGEALSEPGTTFVDAPFAGILGL 187
            :.|:::|.....|:.|||.  .:|:|..|.|.:.|::|..|..|.| :..|..|...|:.||..|
 Worm    89 TKSTSFVEGNRTFSTEYGL--CTGYLGTDTVQMGGLTITKQELGIA-TIVGLGFGLKPYVGIFEL 150

  Fly   188 AFSAIAVDGVTPPFDNMISQGLLDEPVISFYL--KRQGTAV-RGGELILGGIDSSLYRGSLTYVP 249
            |:.|::||.||||...:|||..||.|:.:.:|  |.||..| ..|.:..||.|:.....::|||.
 Worm   151 AWPALSVDQVTPPMQKLISQNQLDAPMFTIWLDQKDQGVYVGYTGLITYGGFDNKNCDANVTYVA 215

  Fly   250 VSVPAYWQ 257
            :|...:||
 Worm   216 LSSKTFWQ 223

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17134NP_609458.1 pepsin_retropepsin_like 70..386 CDD:299705 72/203 (35%)
Asp 75..388 CDD:278455 70/198 (35%)
asp-19NP_001123079.1 pepsin_like 40..>223 CDD:133138 67/187 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160161983
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.840

Return to query results.
Submit another query.