DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17134 and Pga5

DIOPT Version :9

Sequence 1:NP_609458.1 Gene:CG17134 / 34494 FlyBaseID:FBgn0032304 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_067428.2 Gene:Pga5 / 58803 MGIID:1915935 Length:387 Species:Mus musculus


Alignment Length:398 Identity:148/398 - (37%)
Similarity:222/398 - (55%) Gaps:31/398 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MRQLLVLLVLVGIGHSAAKLNRVQLQVNKNFTKTHGSVKAEKTVLASKYSFLAETSFSVSSSGAT 65
            :.:.||.:.|:.|  .:.:.|..:.||.|::.:.:...:|.  ||..:....|.|         .
Mouse    12 LSECLVKIPLMKI--KSMRENLRESQVLKDYLEKYPRSRAH--VLLEQRRNPAVT---------Y 63

  Fly    66 ENLHNSMNNEYYGVIAIGTPEQRFNILFDTGSANLWVPSASCPASNTACQRHNKYDSSASSTYVA 130
            |.:.|.::..|.|:|:||||.|.|.::.||||:.|||||..|  |:.||..|..::...|||::.
Mouse    64 EPMRNYLDLVYIGIISIGTPPQEFRVVLDTGSSVLWVPSIYC--SSPACAHHKAFNPLRSSTFLV 126

  Fly   131 NGEEFAIEYGTGSLSGFLSNDIVTIAGISIQNQTFGEALSEPGTTFVDAPFAGILGLAFSAIAVD 195
            :|....:.||:|.:||||:.|.|.|..:::..|.||.:|.|||.....|.|.|||||.:..:.:.
Mouse   127 SGRPVNVAYGSGEMSGFLAYDTVRIGDLTVVAQAFGLSLEEPGIFMEYAVFDGILGLGYPNLGLQ 191

  Fly   196 GVTPPFDNMISQGLLDEPVISFYLKRQGTAVRGGELILGGIDSSLYRGSLTYVPVSVPAYWQFKV 260
            |:||.|||:..|||:.:.:.:|||..:..  :|..|:|||:|.|.|.|.|.:||||.|:|||..|
Mouse   192 GITPVFDNLWLQGLIPQNLFAFYLSSKDE--KGSMLMLGGVDPSYYHGELHWVPVSKPSYWQLAV 254

  Fly   261 NTIKTNGTLL-CN-GCQAIADTGTSLIAVPLAAYRKINRQLGA-TDNDGEAFVRCGRVSSLPKVN 322
            ::|..||.:: |: |||.|.||||||:..|.::...|...:|| ...|||.|::|..:::||.:.
Mouse   255 DSISMNGEVIACDGGCQGIMDTGTSLLTGPRSSIVNIQNLIGAKASGDGEYFLKCDTINTLPDIV 319

  Fly   323 LNIGGTVFTLAPRDYIVKVTQNGQTYCMSAFTYMEGL------SFWILGDVFIGKFYTVFDKGNE 381
            ..||...:.:....||.|...:.   |.|.|.  ||:      ..|:|||||:..::||||:.|.
Mouse   320 FTIGSVTYPVPASAYIRKDRSHN---CRSNFE--EGMDDPSDPEMWVLGDVFLRLYFTVFDRANN 379

  Fly   382 RIGFARVA 389
            |||.|..|
Mouse   380 RIGLAPAA 387

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17134NP_609458.1 pepsin_retropepsin_like 70..386 CDD:299705 132/324 (41%)
Asp 75..388 CDD:278455 132/321 (41%)
Pga5NP_067428.2 A1_Propeptide 16..44 CDD:285240 8/29 (28%)
pepsin_retropepsin_like 64..385 CDD:299705 133/329 (40%)
Asp 74..386 CDD:278455 132/320 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841582
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1456
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.