DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17134 and pga4

DIOPT Version :9

Sequence 1:NP_609458.1 Gene:CG17134 / 34494 FlyBaseID:FBgn0032304 Length:391 Species:Drosophila melanogaster
Sequence 2:XP_002942158.1 Gene:pga4 / 496914 XenbaseID:XB-GENE-979768 Length:384 Species:Xenopus tropicalis


Alignment Length:404 Identity:164/404 - (40%)
Similarity:229/404 - (56%) Gaps:38/404 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QLLVLLVLVGIGHSAAKL---------NRVQ-LQVNKNFTKTHGSVKAEKTVLASKYSFLAETSF 57
            :||:||.||.:.....|:         ||:| |.:..::.|.:....      ||||       |
 Frog     2 KLLLLLGLVVLSECVVKVPLRKGESFRNRLQRLGLLGDYLKKYPYNP------ASKY-------F 53

  Fly    58 SVSSSGATENLHNSMNNEYYGVIAIGTPEQRFNILFDTGSANLWVPSASCPASNTACQRHNKYDS 122
            ...:..:.|.|.|.|:.||||.|:||||.|.|.::||||||||||||..|  |::||..||:::.
 Frog    54 PTLAQSSAEVLQNYMDIEYYGTISIGTPPQEFTVIFDTGSANLWVPSVYC--SSSACTNHNRFNP 116

  Fly   123 SASSTYVANGEEFAIEYGTGSLSGFLSNDIVTIAGISIQNQTFGEALSEPGTTFVDAPFAGILGL 187
            ..|:|:.|.....:|:|||||:||||..|.:.:..|.|.||.||.:.||||:....:||.|||||
 Frog   117 QQSTTFQATNTPVSIQYGTGSMSGFLGYDTLQVGNIKISNQMFGLSESEPGSFLYYSPFDGILGL 181

  Fly   188 AFSAIAVDGVTPPFDNMISQGLLDEPVISFYLKRQGTAVRGGELILGGIDSSLYRGSLTYVPVSV 252
            ||.:||....||.||||.||||:.:.:.|.||...|.:  |..::.||:|:|.|.|||.:||::.
 Frog   182 AFPSIASSQATPVFDNMWSQGLIPQNLFSVYLSSDGQS--GSYVLFGGVDTSYYSGSLNWVPLTA 244

  Fly   253 PAYWQFKVNTIKTNGTLL-CN-GCQAIADTGTSLIAVPLAAYRKINRQLGAT-DNDGEAFVRCGR 314
            ..|||..:::|..||.:: |: .||||.||||||:..|......|...:||: |::|:..:.|..
 Frog   245 ETYWQIILDSISINGQVIACSQSCQAIVDTGTSLMTGPTTPIANIQYYIGASQDSNGQYVINCNN 309

  Fly   315 VSSLPKVNLNIGGTVFTLAPRDYIVKVTQNGQTYCMSAFTYM----EGLSFWILGDVFIGKFYTV 375
            :|::|.:...|.|..:.|.|..|   |.|| |..|.|.|..|    .....||||||||.:::.|
 Frog   310 ISNMPTIVFTINGVQYPLPPTAY---VRQN-QQGCSSGFQAMTLPTNSGDLWILGDVFIRQYFVV 370

  Fly   376 FDKGNERIGFARVA 389
            ||:.|..:..|.||
 Frog   371 FDRTNNYVAMAPVA 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17134NP_609458.1 pepsin_retropepsin_like 70..386 CDD:299705 142/322 (44%)
Asp 75..388 CDD:278455 141/319 (44%)
pga4XP_002942158.1 A1_Propeptide 16..44 CDD:369623 6/27 (22%)
pepsin_A 62..382 CDD:133145 144/327 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1456
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.110

Return to query results.
Submit another query.