DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17134 and cathD

DIOPT Version :9

Sequence 1:NP_609458.1 Gene:CG17134 / 34494 FlyBaseID:FBgn0032304 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_001334713.1 Gene:cathD / 45268 FlyBaseID:FBgn0029093 Length:392 Species:Drosophila melanogaster


Alignment Length:396 Identity:188/396 - (47%)
Similarity:238/396 - (60%) Gaps:26/396 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 LLVLLVLVGIGHSAAK----LNRVQLQVNKNFTKTHGSVKAEKTVLASKYSFLAETSFSVSSSGA 64
            |||..:...:.|..::    |.||.|...::..:....|..|...|..:|          .....
  Fly     7 LLVAFLAAAVAHPNSQEKPGLLRVPLHKFQSARRHFADVGTELQQLRIRY----------GGGDV 61

  Fly    65 TENLHNSMNNEYYGVIAIGTPEQRFNILFDTGSANLWVPSASCPASNTACQRHNKYDSSASSTYV 129
            .|.|.|.|:.:|||.||||:|.|.|.::|||||:||||||..|..:|.||..|||||:|.|.||.
  Fly    62 PEPLSNYMDAQYYGPIAIGSPPQNFRVVFDTGSSNLWVPSKKCHLTNIACLMHNKYDASKSKTYT 126

  Fly   130 ANGEEFAIEYGTGSLSGFLSNDIVTIAGISIQNQTFGEALSEPGTTFVDAPFAGILGLAFSAIAV 194
            .||.||||:||:|||||:||.|.|:|||:.|::|||.|||||||..||.|.|.|||||.:::|:|
  Fly   127 KNGTEFAIQYGSGSLSGYLSTDTVSIAGLDIKDQTFAEALSEPGLVFVAAKFDGILGLGYNSISV 191

  Fly   195 DGVTPPFDNMISQGLLDEPVISFYLKRQGTAVRGGELILGGIDSSLYRGSLTYVPVSVPAYWQFK 259
            |.|.|||..|..|||:..||.||||.|...:..|||:|.||.|.:.|.|..||:||:..||||.|
  Fly   192 DKVKPPFYAMYEQGLISAPVFSFYLNRDPASPEGGEIIFGGSDPNHYTGEFTYLPVTRKAYWQIK 256

  Fly   260 VNTIKTNGTLLC-NGCQAIADTGTSLIAVPLAAYRKINRQLGATD-NDGEAFVRCGRVSSLPKVN 322
            ::........|| .|||.||||||||||.||.....||:::|.|. ..|:..|.|..:..||.:.
  Fly   257 MDAASIGDLQLCKGGCQVIADTGTSLIAAPLEEATSINQKIGGTPIIGGQYVVSCDLIPQLPVIK 321

  Fly   323 LNIGGTVFTLAPRDYIVKVTQNGQTYCMSAFTYMEGLS-------FWILGDVFIGKFYTVFDKGN 380
            ..:||..|.|..:|||::|.|.|:|.|:|.|.   ||.       .||||||||||:||.||.||
  Fly   322 FVLGGKTFELEGKDYILRVAQMGKTICLSGFM---GLDIPPPNGPLWILGDVFIGKYYTEFDMGN 383

  Fly   381 ERIGFA 386
            :|:|||
  Fly   384 DRVGFA 389

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17134NP_609458.1 pepsin_retropepsin_like 70..386 CDD:299705 172/324 (53%)
Asp 75..388 CDD:278455 172/321 (54%)
cathDNP_001334713.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455562
Domainoid 1 1.000 97 1.000 Domainoid score I1884
eggNOG 1 0.900 - - E1_KOG1339
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 97 1.000 Inparanoid score I1684
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 1 1.000 - - mtm978
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
109.910

Return to query results.
Submit another query.