DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17134 and CG5863

DIOPT Version :9

Sequence 1:NP_609458.1 Gene:CG17134 / 34494 FlyBaseID:FBgn0032304 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_650623.1 Gene:CG5863 / 42096 FlyBaseID:FBgn0038507 Length:395 Species:Drosophila melanogaster


Alignment Length:374 Identity:187/374 - (50%)
Similarity:246/374 - (65%) Gaps:5/374 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 KLNRVQLQVNKNFTKTHGSVKAEKTVLASKYSFLAETSFSVSSSGATENLHNSMNNEYYGVIAIG 83
            :|.|:.:|...:|..:....:|.::.|.:||:.:.....:..:.||||.|.|.:|.||.|.|:||
  Fly    24 QLIRIPMQFQASFMASRRQHRAGRSSLLAKYNVVGGQEVTSRNGGATETLDNRLNLEYAGPISIG 88

  Fly    84 TPEQRFNILFDTGSANLWVPSASCPASNTACQRHNKYDSSASSTYVANGEEFAIEYGTGSLSGFL 148
            :|.|.||:||||||||||||||.|...:.||..|::|::|||||:|.:|..|:|.||||||||.|
  Fly    89 SPGQPFNMLFDTGSANLWVPSAECSPKSVACHHHHRYNASASSTFVPDGRRFSIAYGTGSLSGRL 153

  Fly   149 SNDIVTIAGISIQNQTFGEALSEPGTTFVDAPFAGILGLAFSAIAVDGVTPPFDNMISQGLLDEP 213
            :.|.|.|..:.:||||||.|..|||.||||..||||:||.|..||..|:.|.|::|..|.|:||.
  Fly   154 AQDTVAIGQLVVQNQTFGMATHEPGPTFVDTNFAGIVGLGFRPIAELGIKPLFESMCDQQLVDEC 218

  Fly   214 VISFYLKRQGTAVRGGELILGGIDSSLYRGSLTYVPVSVPAYWQFKVNTIKTNGTLLCNGCQAIA 278
            |.||||||.|:..:||||:.||:|.:.:.|||||||::...||||.::.|:..||.:....||||
  Fly   219 VFSFYLKRNGSERKGGELLFGGVDKTKFSGSLTYVPLTHAGYWQFPLDVIEVAGTRINQNRQAIA 283

  Fly   279 DTGTSLIAVPLAAYRKINRQLGA--TDNDGEAFVRCGRVSSLPKVNLNIGGTVFTLAPRDYIVKV 341
            ||||||:|.|...|..||..||.  |.|: |..:.|..:.|||::...|||..|.|.||||::..
  Fly   284 DTGTSLLAAPPREYLIINSLLGGLPTSNN-EYLLNCSEIDSLPEIVFIIGGQRFGLQPRDYVMSA 347

  Fly   342 T-QNGQTYCMSAFTYMEGLSFWILGDVFIGKFYTVFDKGNERIGFARVA 389
            | .:|.:.|:||||.|:. .||||||||||::||.||.|..|||||..|
  Fly   348 TNDDGSSICLSAFTLMDA-EFWILGDVFIGRYYTAFDAGQRRIGFAPAA 395

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17134NP_609458.1 pepsin_retropepsin_like 70..386 CDD:299705 171/318 (54%)
Asp 75..388 CDD:278455 171/315 (54%)
CG5863NP_650623.1 pepsin_retropepsin_like 71..392 CDD:299705 173/322 (54%)
Asp 80..394 CDD:278455 171/315 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45455537
Domainoid 1 1.000 97 1.000 Domainoid score I1884
eggNOG 1 0.900 - - E1_KOG1339
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 307 1.000 Inparanoid score I2599
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 1 1.000 - - mtm978
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1456
109.900

Return to query results.
Submit another query.