DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17134 and Ren2

DIOPT Version :9

Sequence 1:NP_609458.1 Gene:CG17134 / 34494 FlyBaseID:FBgn0032304 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_112470.2 Gene:Ren2 / 19702 MGIID:97899 Length:424 Species:Mus musculus


Alignment Length:327 Identity:147/327 - (44%)
Similarity:200/327 - (61%) Gaps:11/327 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 LHNSMNNEYYGVIAIGTPEQRFNILFDTGSANLWVPSASCPASNTACQRHNKYDSSASSTYVANG 132
            |.|.:|::|||.|.||||.|.|.::||||||||||||..|.....||..|:.|:||.||:|:.||
Mouse    98 LTNYLNSQYYGEIGIGTPPQTFKVIFDTGSANLWVPSTKCSRLYLACGIHSLYESSDSSSYMENG 162

  Fly   133 EEFAIEYGTGSLSGFLSNDIVTIAGISIQNQTFGEALSEPGTTFVDAPFAGILGLAFSAIAVDGV 197
            ::|.|.||:|.:.||||.|.||:.||:: .|||||....|...|:.|.|.|:||:.|.|.||.||
Mouse   163 DDFTIHYGSGRVKGFLSQDSVTVGGITV-TQTFGEVTELPLIPFMLAQFDGVLGMGFPAQAVGGV 226

  Fly   198 TPPFDNMISQGLLDEPVISFYLKRQGTAVRGGELILGGIDSSLYRGSLTYVPVSVPAYWQFKVNT 262
            ||.||:::|||:|.|.|.|.|..| |..:.|||::|||.|...|:|...||.:|....||..:..
Mouse   227 TPVFDHILSQGVLKEKVFSVYYNR-GPHLLGGEVVLGGSDPEHYQGDFHYVSLSKTDSWQITMKG 290

  Fly   263 IKT-NGTLLC-NGCQAIADTGTSLIAVPLAAYRKINRQLGATDND-GEAFVRCGRVSSLPKVNLN 324
            :.. :.|||| .||:.:.|||:|.|:.|.::.:.|.:.|||.:.. .|..|.|.:|.:||.::.|
Mouse   291 VSVGSSTLLCEEGCEVVVDTGSSFISAPTSSLKLIMQALGAKEKRLHEYVVSCSQVPTLPDISFN 355

  Fly   325 IGGTVFTLAPRDYIVKVTQNGQTYCMSAFTYME-----GLSFWILGDVFIGKFYTVFDKGNERIG 384
            :||..:||:..||:::........|..|...|:     | ..|:||..||.||||.||:.|.|||
Mouse   356 LGGRAYTLSSTDYVLQYPNRRDKLCTVALHAMDIPPPTG-PVWVLGATFIRKFYTEFDRHNNRIG 419

  Fly   385 FA 386
            ||
Mouse   420 FA 421

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17134NP_609458.1 pepsin_retropepsin_like 70..386 CDD:299705 144/323 (45%)
Asp 75..388 CDD:278455 144/320 (45%)
Ren2NP_112470.2 A1_Propeptide 51..76 CDD:285240
renin_like 98..423 CDD:133154 147/327 (45%)
Asp 105..423 CDD:278455 144/320 (45%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
66.030

Return to query results.
Submit another query.