DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG17134 and asp-3

DIOPT Version :9

Sequence 1:NP_609458.1 Gene:CG17134 / 34494 FlyBaseID:FBgn0032304 Length:391 Species:Drosophila melanogaster
Sequence 2:NP_509142.2 Gene:asp-3 / 180947 WormBaseID:WBGene00000216 Length:398 Species:Caenorhabditis elegans


Alignment Length:400 Identity:147/400 - (36%)
Similarity:228/400 - (56%) Gaps:27/400 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 QLLVLLVLVGIGHSAAKLNRVQLQVNKNFTKTH---GSVKAEKTVLASKYSFLAETSFSVSSSGA 64
            ::.:||.||.:   |:.:.|::|: .:.:|:..   ||::..   |.:||    ...:..:....
 Worm     4 RVFLLLALVAL---ASAIQRIKLE-KRTYTREQYKFGSIQEH---LKAKY----VPGYIPNKDAF 57

  Fly    65 TENLHNSMNNEYYGVIAIGTPEQRFNILFDTGSANLWVPSASCPASNTACQRHNKYDSSASSTYV 129
            .|.|.:..|.:|||.:.||||.|.|.:||||||:|||||.|:||..:.||:.||::|...||:..
 Worm    58 NEGLSDYSNAQYYGPVTIGTPPQNFQVLFDTGSSNLWVPCANCPFGDIACRMHNRFDCKKSSSCT 122

  Fly   130 ANGEEFAIEYGTGSLSGFLSNDIVTIAG----ISIQNQTFGEALSEPGTTFVDAPFAGILGLAFS 190
            |.|..|.|:|||||:.|.:.||:|....    .:.:||....|.||||.|||.|.|.||.|:.:.
 Worm   123 ATGASFEIQYGTGSMKGTVDNDVVCFGHDTTYCTDKNQGLACATSEPGITFVAAKFDGIFGMGWD 187

  Fly   191 AIAVDGVTPPFDNMI-SQGLLDEPVISFYLKRQGTAV-RGGELILGGIDSSLYRGSLTYVPVSVP 253
            .|:|:.::.|.|.:. :..:....:.:|:|.|....: .|||:.|...|.:.|.|::.:.|:...
 Worm   188 TISVNKISQPMDQIFANSAICKNQLFAFWLSRDANDITNGGEITLCDTDPNHYVGNIAWEPLVSE 252

  Fly   254 AYWQFKVNTIKTNGTLLCNG-CQAIADTGTSLIAVPLAAYRKINRQLGATD-NDGEAFVRCGRVS 316
            .||:.|:.::..:||...:| ..:|.||||||:..|....:||..::|... .:||..|.|.::.
 Worm   253 DYWRIKLASVVIDGTTYTSGPIDSIVDTGTSLLTGPTDVIKKIQHKIGGIPLFNGEYEVECSKIP 317

  Fly   317 SLPKVNLNIGGTVFTLAPRDYIVKVTQ-NGQTYCMSAFTYME----GLSFWILGDVFIGKFYTVF 376
            |||.:..|:||..|.|..:|||::::. ||.:.|:|.|..|:    ....|||||||||:||:||
 Worm   318 SLPNITFNLGGQNFDLQGKDYILQMSNGNGGSTCLSGFMGMDIPAPAGPLWILGDVFIGRFYSVF 382

  Fly   377 DKGNERIGFA 386
            |.||:|:|||
 Worm   383 DHGNKRVGFA 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG17134NP_609458.1 pepsin_retropepsin_like 70..386 CDD:299705 130/328 (40%)
Asp 75..388 CDD:278455 130/324 (40%)
asp-3NP_509142.2 pepsin_retropepsin_like 59..393 CDD:299705 133/333 (40%)
Asp 68..393 CDD:278455 130/324 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4148
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
87.840

Return to query results.
Submit another query.