DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6508 and YPS6

DIOPT Version :9

Sequence 1:NP_609457.1 Gene:CG6508 / 34493 FlyBaseID:FBgn0032303 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_012305.3 Gene:YPS6 / 854857 SGDID:S000001478 Length:537 Species:Saccharomyces cerevisiae


Alignment Length:458 Identity:106/458 - (23%)
Similarity:185/458 - (40%) Gaps:113/458 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 VDRQSSQTTQVLANGFNLEYTIRLCIGTPPQCFNLQFDTGSSDLWV------------------- 100
            |.:::......:.||..: |.:::.||||||...||.||||||:.|                   
Yeast    49 VFKRNEVLNTTVINGIGV-YVVKMEIGTPPQTLYLQLDTGSSDMIVNNADIAYCKSMSDGSDYAS 112

  Fly   101 -------------PSVKCSST--NEACQKHNKYNSSASSSHVEDGKGFSIQYGSGS-LSGFLSTD 149
                         ||...||.  |..|.....:::|.||:...:...|:..||.|: .:|...||
Yeast   113 TDNYELTATFNGLPSTTISSEAYNTLCSYWGTFDASNSSTFENNATFFNNTYGDGTYYAGTYGTD 177

  Fly   150 TVDIDGMVIRNQTFAEAIDEPGSAFVNTIFDGIIGMA--FASISGGV-------TTPF--DN--- 200
            .|..:.:.:.:.||..:.|..|:.      .||:|::  .|..:.|:       .|||  ||   
Yeast   178 VVSFENITLNDFTFGVSNDTIGNP------SGILGISLPIAEFTDGIEYALALNRTPFIYDNFPM 236

  Fly   201 -IIRQGLVKHPVFSVYLRRDGTSQSGGEVIWGGIDRSIYRGCINYVPV--------SMPAYWQFT 256
             :..||.:....:|::|  :|.....|.:::|.:|:|.|.|.:..:|:        |.|. ...|
Yeast   237 ELKNQGKINKIAYSLFL--NGPDAHFGSILFGAVDKSKYTGQLYTLPMLQAFNTLGSNPG-MIIT 298

  Fly   257 ANSVKI----EGILLCNGCQ--AIADTGTSLIAVPLRAYKAINKVLNATDAGDGEAFV-DCSSLC 314
            |.||.|    .|....:..|  .:.|:||:...:|....:||.|..:...:.|.:.:: |||.: 
Yeast   299 AQSVAILDSESGNKTVSDIQFPVMLDSGTTFSYLPTEIAEAIGKSFDGEYSSDDQGYIFDCSKV- 362

  Fly   315 RLPN---VNLNIGGTTYTLTPKDYIYKVQADNNQTLCLSGFTYLQGNLLWILGDIFLGKVYTVFD 376
               |   ::::.||...:....:::     .:.:..|:  ....|....::|||.||...|.|:|
Yeast   363 ---NDTLLSVDFGGFNISANISNFV-----TSAKDRCV--LNVKQSESTYMLGDAFLVDAYVVYD 417

  Fly   377 VGKERIGFAKL---KKHSSYRV-------------YASSYVKEPSS-------YGIDYPFYGDEY 418
            :....|..|:.   .:.....|             |.|::|.:|.|       ..:.:..| .|:
Yeast   418 LENYEISIAQASFNNQEEDIEVISDTVPGATPAPGYFSTWVYKPGSPIGTGDFINVSWTSY-SEF 481

  Fly   419 SRF 421
            |::
Yeast   482 SQY 484

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6508NP_609457.1 pepsin_retropepsin_like 68..386 CDD:299705 95/385 (25%)
Asp 73..387 CDD:278455 94/381 (25%)
YPS6NP_012305.3 SAP_like 65..428 CDD:133141 94/383 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.