DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6508 and BAR1

DIOPT Version :9

Sequence 1:NP_609457.1 Gene:CG6508 / 34493 FlyBaseID:FBgn0032303 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_012249.1 Gene:BAR1 / 854797 SGDID:S000001277 Length:587 Species:Saccharomyces cerevisiae


Alignment Length:417 Identity:106/417 - (25%)
Similarity:173/417 - (41%) Gaps:98/417 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 LLAAKYFLVDRQSSQTTQ-------VLANGFNLEYTIRLCIGTPPQCFNLQFDTGSSDLWV---- 100
            |:.|.:.:::..::.|..       :|.:...:.|...|.||||.|...:.|||||:|.||    
Yeast    11 LILASFAIINTITALTNDGTGHLEFLLQHEEEMYYATTLDIGTPSQSLTVLFDTGSADFWVMDSS 75

  Fly   101 -----PSVKCSSTNEA------------CQKHNKYNSSASSS--HVEDGKGFSIQYGSGSLS-GF 145
                 |:...||.:.|            |:..:.||...||:  ::|:|: |.|.|..|:.: |.
Yeast    76 NPFCLPNSNTSSYSNATYNGEEVKPSIDCRSMSTYNEHRSSTYQYLENGR-FYITYADGTFADGS 139

  Fly   146 LSTDTVDIDGMVIRNQTFAEAIDEPGSAFVNTIFDGIIGMAF---ASISGGVTTP------FDNI 201
            ..|:||.|:|:.|.|..|..|      .:..|...|::|:.|   .|:.|....|      |..|
Yeast   140 WGTETVSINGIDIPNIQFGVA------KYATTPVSGVLGIGFPRRESVKGYEGAPNEYYPNFPQI 198

  Fly   202 IR-QGLVKHPVFSVYLRRDGTSQSG-GEVIWGGIDRSIYRG------CINYVP--VSMPAYWQFT 256
            :: :.::....:|::|   .:..|| |.:::|.||.|.:.|      .:|..|  |..||....|
Yeast   199 LKSEKIIDVVAYSLFL---NSPDSGTGSIVFGAIDESKFSGDLFTFPMVNEYPTIVDAPATLAMT 260

  Fly   257 ANSVKIEGILLCN--GCQ----------AIADTGTSLIAVPLRAYKAINKVLNAT-DAGDGEAFV 308
                 |:|:...|  .|:          .:.|:||||:..|......:...:||: ...:|...:
Yeast   261 -----IQGLGAQNKSSCEHETFTTTKYPVLLDSGTSLLNAPKVIADKMASFVNASYSEEEGIYIL 320

  Fly   309 DCSSLCRLPNVNLNIGGTTYTLTPKDYIYKVQADNNQTLCLS--------GFTYLQGNLLWILGD 365
            ||.         :::|...|.....|....|..   .:|.||        ||.....|...:|||
Yeast   321 DCP---------VSVGDVEYNFDFGDLQISVPL---SSLILSPETEGSYCGFAVQPTNDSMVLGD 373

  Fly   366 IFLGKVYTVFDVGKERIGFAKLKKHSS 392
            :||...|.|||:...:|..|:...::|
Yeast   374 VFLSSAYVVFDLDNYKISLAQANWNAS 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6508NP_609457.1 pepsin_retropepsin_like 68..386 CDD:299705 100/381 (26%)
Asp 73..387 CDD:278455 101/377 (27%)
BAR1NP_012249.1 SAP_like 43..395 CDD:133141 101/378 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.770

Return to query results.
Submit another query.