DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6508 and YGL258W-A

DIOPT Version :10

Sequence 1:NP_609457.1 Gene:CG6508 / 34493 FlyBaseID:FBgn0032303 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_076890.1 Gene:YGL258W-A / 852633 SGDID:S000007607 Length:77 Species:Saccharomyces cerevisiae


Alignment Length:72 Identity:17/72 - (23%)
Similarity:39/72 - (54%) Gaps:7/72 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly   203 RQGLVKHPV-FSVYLRRDGTSQSGGEVIWGGIDRSIYRGCINYVPVSMPAYWQFTANS---VKIE 263
            |||.::..: :|::|  :|.:...|.:::|.:|:|.|...:...|:.. ||....:||   :.::
Yeast     5 RQGKIEKKISYSLFL--NGPNVHFGSILFGAVDKSKYAEELCTHPMRQ-AYNTLDSNSRIIITVQ 66

  Fly   264 GILLCNG 270
            .:.:.:|
Yeast    67 SVAILDG 73

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6508NP_609457.1 pepsin_retropepsin_like 68..386 CDD:472175 17/72 (24%)
YGL258W-ANP_076890.1 pepsin_retropepsin_like <6..>74 CDD:472175 16/71 (23%)

Return to query results.
Submit another query.