DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6508 and mgc108380

DIOPT Version :9

Sequence 1:NP_609457.1 Gene:CG6508 / 34493 FlyBaseID:FBgn0032303 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_001027480.1 Gene:mgc108380 / 613072 -ID:- Length:384 Species:Xenopus tropicalis


Alignment Length:402 Identity:153/402 - (38%)
Similarity:222/402 - (55%) Gaps:47/402 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 IPLFLLLLDHSMGQLRRTPITRQINQNKTHANVKAEKILLAAKYFLVDRQSSQTTQVLANGFNLE 73
            :.|..:.|..|.| |.|.|:.|.    |:..::..|:.:|  |.|:   ::.:....|...||.:
 Frog     4 VVLAFICLQLSEG-LVRVPLKRY----KSARDIMRERGIL--KEFM---KTHKRDPALKYHFNEK 58

  Fly    74 YTI---------------RLCIGTPPQCFNLQFDTGSSDLWVPSVKCSSTNEACQKHNKYNSSAS 123
            |..               .:.||||||.|.:.||||||:|||||..|.|  |||..||.:|.|.|
 Frog    59 YDFAVAYEPMYMDTYYYGEISIGTPPQNFLVLFDTGSSNLWVPSTSCQS--EACSNHNLFNPSQS 121

  Fly   124 SSHVEDGKGFSIQYGSGSLSGFLSTDTVDIDGMVIRNQTFAEAIDEPGSAFVNTIFDGIIGMAFA 188
            |::..:|:.||:.|||||::|....|||.:.|:.:.||.|.....|.||:|..:.||||.|||:.
 Frog   122 STYTSNGQQFSMSYGSGSVTGVFGYDTVTVQGLSLNNQEFGLTYTESGSSFYYSKFDGIFGMAYP 186

  Fly   189 SIS-GGVTTPFDNIIRQGLVKHPVFSVYLRRDGTSQSGGEVIWGGIDRSIYRGCINYVPVSMPAY 252
            ::| ||.||....:::|.|:.:|:||||:    :||| ||||:||:|.::|.|.|.:.||:...|
 Frog   187 AMSAGGATTAMQGMLQQNLLTYPIFSVYM----SSQS-GEVIFGGVDNNLYSGQIQWSPVTQEVY 246

  Fly   253 WQFTANSVKIEGILL--CN-GCQAIADTGTSLIAVPLRAYKAINKVLNATDAGDGEAFVDCSSLC 314
            ||...:...|.|...  |: |||||.|||||.:.:|.:....:.:.|.|.:. :|...|:|:|:.
 Frog   247 WQIGIDEFLINGQATGWCSQGCQAIVDTGTSPLTIPQQYMGTLLQNLGAQNY-NGMFVVNCNSVQ 310

  Fly   315 RLPNVNLNIGGTTYTLTPKDYIYKVQADNNQTLCLSGF--TYL---QGNLLWILGDIFLGKVYTV 374
            .||.:...|.|..:.:.|..||  ||.:.   .|..|.  |||   .|..||||||:||.:.|:|
 Frog   311 NLPTITFVINGVQFPIPPSGYI--VQTNG---YCTVGVEETYLPSQNGQPLWILGDVFLRQYYSV 370

  Fly   375 FDVGKERIGFAK 386
            :|:...|:|||:
 Frog   371 YDMSNNRVGFAQ 382

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6508NP_609457.1 pepsin_retropepsin_like 68..386 CDD:299705 138/341 (40%)
Asp 73..387 CDD:278455 137/338 (41%)
mgc108380NP_001027480.1 A1_Propeptide 17..45 CDD:369623 9/36 (25%)
pepsin_retropepsin_like 71..383 CDD:386101 136/325 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1456
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.