DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6508 and pgc-like.1

DIOPT Version :9

Sequence 1:NP_609457.1 Gene:CG6508 / 34493 FlyBaseID:FBgn0032303 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_001025603.1 Gene:pgc-like.1 / 594991 XenbaseID:XB-GENE-964422 Length:385 Species:Xenopus tropicalis


Alignment Length:401 Identity:154/401 - (38%)
Similarity:216/401 - (53%) Gaps:54/401 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LIIIPLFLLLLDHSMGQLRRTPITRQINQN--KTHANVKAEKILLAAKYFLVDRQSSQTTQVLAN 68
            ||.:||      |....:|.|...:.:.:.  |||....|.|.    ||            .|.|
 Frog    17 LIRVPL------HKSKTIRETMKEKGVLKEFMKTHKREPAMKY----KY------------NLKN 59

  Fly    69 GFNLEYTI---------RLCIGTPPQCFNLQFDTGSSDLWVPSVKCSSTNEACQKHNKYNSSASS 124
            .|.:.|..         ::.:|||||.|.:.||||||:|||.|..|.|  .|||.|..:|.|.||
 Frog    60 DFAIAYEPMYMDAAYYGQISVGTPPQNFMVLFDTGSSNLWVASTYCQS--GACQNHPLFNPSQSS 122

  Fly   125 SHVEDGKGFSIQYGSGSLSGFLSTDTVDIDGMVIRNQTFAEAIDEPGSAFVNTIFDGIIGMAFAS 189
            ::....:.|||.||||||:|....|||.:.|:.|.||....:|:|||:.||.:.|:||.|||:.:
 Frog   123 TYTSKNQQFSITYGSGSLTGVFGYDTVTVQGLSITNQEIGLSINEPGTNFVYSSFEGIFGMAYPA 187

  Fly   190 I-SGGVTTPFDNIIRQGLVKHPVFSVYLRRDGTSQSGGEVIWGGIDRSIYRGCINYVPVSMPAYW 253
            : :||.|||...:::|.|:.:|:||||:    :||| ||||:||:|.|:|.|.|.:.||:...||
 Frog   188 LAAGGATTPMQGMLQQNLLTYPIFSVYM----SSQS-GEVIFGGVDSSLYSGQIYWAPVTQELYW 247

  Fly   254 QFTANSVKIEGILL--CN-GCQAIADTGTSLIAVPLRAYKAINKVLNATDAGDGEAFVDCSSLCR 315
            |...:...|.|...  |: ||||:.||||||:.||.:......:.|.|.....||..|:|:::..
 Frog   248 QIAIDEFSINGQATGWCSQGCQAMVDTGTSLLTVPQQFMGTFLQSLGAQQNQYGEYIVNCNNVQS 312

  Fly   316 LPNVNLNIGGTTYTLTPKDYIYKVQADNNQTLCLSG--FTYL---QGNLLWILGDIFLGKVYTVF 375
            ||.::..|.|..:.:.|..||.:     |...|..|  .|||   .|...|||||:||.:.|:|:
 Frog   313 LPPISFTINGVQFPIPPSAYILQ-----NNGYCSVGVEVTYLPSQNGQPFWILGDVFLRQYYSVY 372

  Fly   376 DVGKERIGFAK 386
            |:|..|:|||:
 Frog   373 DMGNNRVGFAQ 383

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6508NP_609457.1 pepsin_retropepsin_like 68..386 CDD:299705 138/335 (41%)
Asp 73..387 CDD:278455 137/332 (41%)
pgc-like.1NP_001025603.1 A1_Propeptide 17..45 CDD:369623 8/33 (24%)
pepsin_retropepsin_like 71..382 CDD:386101 134/322 (42%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1456
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.