DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6508 and Pga5

DIOPT Version :9

Sequence 1:NP_609457.1 Gene:CG6508 / 34493 FlyBaseID:FBgn0032303 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_067428.2 Gene:Pga5 / 58803 MGIID:1915935 Length:387 Species:Mus musculus


Alignment Length:392 Identity:141/392 - (35%)
Similarity:215/392 - (54%) Gaps:35/392 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LIIIPLFLLLLDHSMGQ-LRRTPITRQINQN--KTHANVKAEKILLAAKYFLVDRQSSQTTQVLA 67
            |:.|||..:   .||.: ||.:.:.:...:.  ::.|:|..|:          .|..:.|.:.:.
Mouse    16 LVKIPLMKI---KSMRENLRESQVLKDYLEKYPRSRAHVLLEQ----------RRNPAVTYEPMR 67

  Fly    68 NGFNLEYTIRLCIGTPPQCFNLQFDTGSSDLWVPSVKCSSTNEACQKHNKYNSSASSSHVEDGKG 132
            |..:|.|...:.||||||.|.:..|||||.|||||:.|||  .||..|..:|...||:.:..|:.
Mouse    68 NYLDLVYIGIISIGTPPQEFRVVLDTGSSVLWVPSIYCSS--PACAHHKAFNPLRSSTFLVSGRP 130

  Fly   133 FSIQYGSGSLSGFLSTDTVDIDGMVIRNQTFAEAIDEPGSAFVNTIFDGIIGMAFASIS-GGVTT 196
            .::.||||.:||||:.|||.|..:.:..|.|..:::|||......:||||:|:.:.::. .|:|.
Mouse   131 VNVAYGSGEMSGFLAYDTVRIGDLTVVAQAFGLSLEEPGIFMEYAVFDGILGLGYPNLGLQGITP 195

  Fly   197 PFDNIIRQGLVKHPVFSVYLRRDGTSQSGGEVIWGGIDRSIYRGCINYVPVSMPAYWQFTANSVK 261
            .|||:..|||:...:|:.||  ....:.|..::.||:|.|.|.|.:::||||.|:|||...:|:.
Mouse   196 VFDNLWLQGLIPQNLFAFYL--SSKDEKGSMLMLGGVDPSYYHGELHWVPVSKPSYWQLAVDSIS 258

  Fly   262 IEG-ILLCN-GCQAIADTGTSLIAVPLRAYKAINKVLNATDAGDGEAFVDCSSLCRLPNVNLNIG 324
            :.| ::.|: |||.|.||||||:..|..:...|..::.|..:||||.|:.|.::..||::...||
Mouse   259 MNGEVIACDGGCQGIMDTGTSLLTGPRSSIVNIQNLIGAKASGDGEYFLKCDTINTLPDIVFTIG 323

  Fly   325 GTTYTLTPKDYIYKVQADNNQTLCLSGFTYLQG------NLLWILGDIFLGKVYTVFDVGKERIG 383
            ..||.:....||.|.::.|    |.|.|.  :|      ..:|:|||:||...:||||....|||
Mouse   324 SVTYPVPASAYIRKDRSHN----CRSNFE--EGMDDPSDPEMWVLGDVFLRLYFTVFDRANNRIG 382

  Fly   384 FA 385
            .|
Mouse   383 LA 384

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6508NP_609457.1 pepsin_retropepsin_like 68..386 CDD:299705 128/327 (39%)
Asp 73..387 CDD:278455 126/322 (39%)
Pga5NP_067428.2 A1_Propeptide 16..44 CDD:285240 8/30 (27%)
pepsin_retropepsin_like 64..385 CDD:299705 128/331 (39%)
Asp 74..386 CDD:278455 126/321 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841584
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54317
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1456
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
98.860

Return to query results.
Submit another query.