DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6508 and Bace2

DIOPT Version :9

Sequence 1:NP_609457.1 Gene:CG6508 / 34493 FlyBaseID:FBgn0032303 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_062390.3 Gene:Bace2 / 56175 MGIID:1860440 Length:514 Species:Mus musculus


Alignment Length:375 Identity:103/375 - (27%)
Similarity:173/375 - (46%) Gaps:70/375 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    62 TTQVLANGFNLE------YTIRLCIGTPPQCFNLQFDTGSSDLWVPSVKCSSTNEACQKHNKYNS 120
            |...||...||:      |.:.:.||||||...:..|||||:..|.....|..:      ..::|
Mouse    70 TANFLAMVDNLQGDSGRGYYLEMLIGTPPQKVQILVDTGSSNFAVAGAPHSYID------TYFDS 128

  Fly   121 SASSSHVEDGKGFSIQYGSGSLSGFLSTDTVDI-DGMVIRNQTF---AEAIDEPGSAFVNTI-FD 180
            .:||::...|...:::|..||.:||:..|.|.| .|.   |.:|   ...|.|..:.|:..| ::
Mouse   129 ESSSTYHSKGFDVTVKYTQGSWTGFVGEDLVTIPKGF---NSSFLVNIATIFESENFFLPGIKWN 190

  Fly   181 GIIGMAFASI---SGGVTTPFDNIIRQGLVKHPVFSVY-----LRRDGTSQSGGEVIWGGIDRSI 237
            ||:|:|:|::   |..:.|.||:::.|..:. .:||:.     |...|:..:||.::.|||:.|:
Mouse   191 GILGLAYAALAKPSSSLETFFDSLVAQAKIP-DIFSMQMCGAGLPVAGSGTNGGSLVLGGIEPSL 254

  Fly   238 YRGCINYVPVSMPAYWQFTANSVKIEGILL---C---NGCQAIADTGTSLIAVPLRAYKAINKVL 296
            |:|.|.|.|:....|:|.....::|.|..|   |   |..:||.|:||:|:.:|.:.:.|:.:.:
Mouse   255 YKGDIWYTPIKEEWYYQIEILKLEIGGQNLNLDCREYNADKAIVDSGTTLLRLPQKVFDAVVEAV 319

  Fly   297 NAT----DAGDG---EAFVDC-----SSLCRLPNVNLNIGGTT------YTLTPKDYIYKVQADN 343
            ..|    :..||   .|.:.|     :.....|.:::.:....      .|:.|:.||       
Mouse   320 ARTSLIPEFSDGFWTGAQLACWTNSETPWAYFPKISIYLRDENASRSFRITILPQLYI------- 377

  Fly   344 NQTLCLSGFTY--------LQGNLLWILGDIFLGKVYTVFDVGKERIGFA 385
             |.:..:||.|        ...|.| ::|...:...|.|||..:.|:|||
Mouse   378 -QPMMGAGFNYECYRFGISSSTNAL-VIGATVMEGFYVVFDRAQRRVGFA 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6508NP_609457.1 pepsin_retropepsin_like 68..386 CDD:299705 100/369 (27%)
Asp 73..387 CDD:278455 98/364 (27%)
Bace2NP_062390.3 beta_secretase_like 85..446 CDD:133140 98/360 (27%)
Asp 88..425 CDD:278455 96/355 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167841608
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.