DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6508 and pga4

DIOPT Version :9

Sequence 1:NP_609457.1 Gene:CG6508 / 34493 FlyBaseID:FBgn0032303 Length:423 Species:Drosophila melanogaster
Sequence 2:XP_002942158.1 Gene:pga4 / 496914 XenbaseID:XB-GENE-979768 Length:384 Species:Xenopus tropicalis


Alignment Length:336 Identity:143/336 - (42%)
Similarity:201/336 - (59%) Gaps:20/336 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 AAKYFLVDRQSSQTTQVLANGFNLEYTIRLCIGTPPQCFNLQFDTGSSDLWVPSVKCSSTNEACQ 113
            |:|||....|||  .:||.|..::||...:.||||||.|.:.|||||::||||||.|||:  ||.
 Frog    49 ASKYFPTLAQSS--AEVLQNYMDIEYYGTISIGTPPQEFTVIFDTGSANLWVPSVYCSSS--ACT 109

  Fly   114 KHNKYNSSASSSHVEDGKGFSIQYGSGSLSGFLSTDTVDIDGMVIRNQTFAEAIDEPGSAFVNTI 178
            .||::|...|::........|||||:||:||||..||:.:..:.|.||.|..:..||||....:.
 Frog   110 NHNRFNPQQSTTFQATNTPVSIQYGTGSMSGFLGYDTLQVGNIKISNQMFGLSESEPGSFLYYSP 174

  Fly   179 FDGIIGMAFASISGGVTTP-FDNIIRQGLVKHPVFSVYLRRDGTSQSGGEVIWGGIDRSIYRGCI 242
            ||||:|:||.||:....|| |||:..|||:...:|||||..||  |||..|::||:|.|.|.|.:
 Frog   175 FDGILGLAFPSIASSQATPVFDNMWSQGLIPQNLFSVYLSSDG--QSGSYVLFGGVDTSYYSGSL 237

  Fly   243 NYVPVSMPAYWQFTANSVKIEG-ILLCN-GCQAIADTGTSLIAVPLRAYKAINKVLNATDAGDGE 305
            |:||::...|||...:|:.|.| ::.|: .||||.||||||:..|......|...:.|:...:|:
 Frog   238 NWVPLTAETYWQIILDSISINGQVIACSQSCQAIVDTGTSLMTGPTTPIANIQYYIGASQDSNGQ 302

  Fly   306 AFVDCSSLCRLPNVNLNIGGTTYTLTPKDYIYKVQADNNQTLCLSGFTYL-----QGNLLWILGD 365
            ..::|:::..:|.:...|.|..|.|.|..|:.:     ||..|.|||..:     .|: ||||||
 Frog   303 YVINCNNISNMPTIVFTINGVQYPLPPTAYVRQ-----NQQGCSSGFQAMTLPTNSGD-LWILGD 361

  Fly   366 IFLGKVYTVFD 376
            :|:.:.:.|||
 Frog   362 VFIRQYFVVFD 372

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6508NP_609457.1 pepsin_retropepsin_like 68..386 CDD:299705 134/317 (42%)
Asp 73..387 CDD:278455 133/312 (43%)
pga4XP_002942158.1 A1_Propeptide 16..44 CDD:369623
pepsin_A 62..382 CDD:133145 136/321 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 1 1.000 - - FOG0000066
OrthoInspector 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR47966
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1456
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
55.110

Return to query results.
Submit another query.