DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6508 and XB964428

DIOPT Version :9

Sequence 1:NP_609457.1 Gene:CG6508 / 34493 FlyBaseID:FBgn0032303 Length:423 Species:Drosophila melanogaster
Sequence 2:XP_002933025.1 Gene:XB964428 / 496913 XenbaseID:XB-GENE-964429 Length:383 Species:Xenopus tropicalis


Alignment Length:392 Identity:150/392 - (38%)
Similarity:222/392 - (56%) Gaps:24/392 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 QLIIIPLFLLLLDHSMGQ--LRRTPITRQINQNKTHANVKAEKILLAAKYFLVDRQSSQTTQVLA 67
            :.:|:.|..|.|...:.:  |:|....|::.:..   .:||..:..|:||:   .|.:...:.||
 Frog     2 KFLILALVCLQLSEGIIKVPLKRFKSMREVMREH---GIKAPIVDPASKYY---NQYATAFEPLA 60

  Fly    68 NGFNLEYTIRLCIGTPPQCFNLQFDTGSSDLWVPSVKCSSTNEACQKHNKYNSSASSSHVEDGKG 132
            |..::.|...:.||||||.|.:.||||||:|||.|..|.|  :||..|..:|.|.||::..:.:.
 Frog    61 NYMDMSYYGEISIGTPPQNFLVLFDTGSSNLWVASTNCQS--QACTNHPLFNPSQSSTYSSNQQQ 123

  Fly   133 FSIQYGSGSLSGFLSTDTVDIDGMVIRNQTFAEAIDEPGSAFVNTIFDGIIGMAFASIS-GGVTT 196
            ||:|||:|||:|.|..|||.|..:.|..|.|..::.|||:.||...||||:|:|:.||: ||.||
 Frog   124 FSLQYGTGSLTGILGYDTVTIQNIAISQQEFGLSVTEPGTNFVYAQFDGILGLAYPSIAVGGATT 188

  Fly   197 PFDNIIRQGLVKHPVFSVYLRRDGTSQSGGEVIWGGIDRSIYRGCINYVPVSMPAYWQFTANSVK 261
            ....:::|.|:..|||..||..:.| ||||||.:||:|::.|.|.|.:.||:...|||.......
 Frog   189 VMQGMLQQNLLNEPVFGFYLSGENT-QSGGEVAFGGVDQNYYTGQIYWTPVTSETYWQIGIQGFS 252

  Fly   262 IEGIL--LCN-GCQAIADTGTSLIAVPLRAYKAINKVLNATDAGDGEAFVDCSSLCRLPNVNLNI 323
            |.|..  .|: |||.|.||||||:..|...:.::.:.:.|....:||..|.|||:..||.::..|
 Frog   253 INGQASGWCSQGCQGIVDTGTSLLTAPQSIFASLMQDIGAQQDQNGEYVVSCSSIQNLPTISFTI 317

  Fly   324 GGTTYTLTPKDYIYKVQADNNQTLCLSGF--TYL---QGNLLWILGDIFLGKVYTVFDVGKERIG 383
            .|.::.|.|..|:.:    .:...|..|.  |||   .|..:|||||:||.:.|:|:|:|..::|
 Frog   318 SGVSFPLPPSAYVLQ----QSSGYCTIGIMPTYLSSQNGQPMWILGDVFLRQYYSVYDLGNNQVG 378

  Fly   384 FA 385
            ||
 Frog   379 FA 380

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6508NP_609457.1 pepsin_retropepsin_like 68..386 CDD:299705 135/327 (41%)
Asp 73..387 CDD:278455 134/322 (42%)
XB964428XP_002933025.1 A1_Propeptide 17..>36 CDD:369623 3/21 (14%)
pepsin_retropepsin_like 64..382 CDD:386101 134/324 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1619495at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.