DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG6508 and BACE1

DIOPT Version :9

Sequence 1:NP_609457.1 Gene:CG6508 / 34493 FlyBaseID:FBgn0032303 Length:423 Species:Drosophila melanogaster
Sequence 2:NP_036236.1 Gene:BACE1 / 23621 HGNCID:933 Length:501 Species:Homo sapiens


Alignment Length:371 Identity:104/371 - (28%)
Similarity:167/371 - (45%) Gaps:62/371 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    74 YTIRLCIGTPPQCFNLQFDTGSSDLWV-----PSVKCSSTNEACQKHNKYNSSASSSHVEDGKGF 133
            |.:.:.:|:|||..|:..|||||:..|     |.:           |..|....||::.:..||.
Human    75 YYVEMTVGSPPQTLNILVDTGSSNFAVGAAPHPFL-----------HRYYQRQLSSTYRDLRKGV 128

  Fly   134 SIQYGSGSLSGFLSTDTVDI-DGMVIRNQTFAEAIDEPGSAFVN-TIFDGIIGMAFASIS---GG 193
            .:.|..|...|.|.||.|.| .|..:..:....||.|....|:| :.::||:|:|:|.|:   ..
Human   129 YVPYTQGKWEGELGTDLVSIPHGPNVTVRANIAAITESDKFFINGSNWEGILGLAYAEIARPDDS 193

  Fly   194 VTTPFDNIIRQGLVKHPVFSVYLRRDG--TSQS------GGEVIWGGIDRSIYRGCINYVPVSMP 250
            :...||::::|..|.: :||:.|...|  .:||      ||.:|.||||.|:|.|.:.|.|:...
Human   194 LEPFFDSLVKQTHVPN-LFSLQLCGAGFPLNQSEVLASVGGSMIIGGIDHSLYTGSLWYTPIRRE 257

  Fly   251 AYWQFTANSVKIEGILLCNGC------QAIADTGTSLIAVPLRAYKAINKVLNATDAGDGEAFVD 309
            .|::.....|:|.|..|...|      ::|.|:||:.:.:|.:.::|..|.:.|  |...|.|.|
Human   258 WYYEVIIVRVEINGQDLKMDCKEYNYDKSIVDSGTTNLRLPKKVFEAAVKSIKA--ASSTEKFPD 320

  Fly   310 CSSLCR--------------LPNVNLNIGGTT------YTLTPKDYIYKVQ-ADNNQTLCLSGFT 353
            ...|..              .|.::|.:.|..      .|:.|:.|:..|: ...:|..|.. |.
Human   321 GFWLGEQLVCWQAGTTPWNIFPVISLYLMGEVTNQSFRITILPQQYLRPVEDVATSQDDCYK-FA 384

  Fly   354 YLQGNLLWILGDIFLGKVYTVFDVGKERIGFA--KLKKHSSYRVYA 397
            ..|.:...::|.:.:...|.|||..::|||||  ....|..:|..|
Human   385 ISQSSTGTVMGAVIMEGFYVVFDRARKRIGFAVSACHVHDEFRTAA 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG6508NP_609457.1 pepsin_retropepsin_like 68..386 CDD:299705 101/358 (28%)
Asp 73..387 CDD:278455 101/359 (28%)
BACE1NP_036236.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 39..58
beta_secretase_like 72..437 CDD:133140 104/371 (28%)
Interaction with RTN3 479..501
DXXLL. /evidence=ECO:0000269|PubMed:15886016 496..500
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165151466
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1339
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S4239
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
43.690

Return to query results.
Submit another query.